2Q7X,2HZB,2PPV


Conserved Protein Domain Family
YvcK_like

?
cd07187: YvcK_like 
Click on image for an interactive view with Cn3D
family of mostly uncharacterized proteins similar to B.subtilis YvcK
One member of this protein family, YvcK from Bacillus subtilis, has been proposed to play a role in carbon metabolism, since its function is essential for growth on intermediates of the Krebs cycle and the pentose phosphate pathway. In general, this family of mostly uncharacterized proteins is related to the CofD-like protein family. CofD has been characterized as a 2-phospho-L-lactate transferase involved in F420 biosynthesis. This family appears to have the same conserved phosphate binding site as the other family in this hierarchy, but a different substrate binding site.
Statistics
?
PSSM-Id: 132873
View PSSM: cd07187
Aligned: 56 rows
Threshold Bit Score: 202.026
Threshold Setting Gi: 16944482
Created: 26-Jan-2009
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 5 residues -Click on image for an interactive view with Cn3D
Feature 1:putative substrate binding pocket [chemical binding site]
Evidence:
  • Comment:based on homology to other members of the family

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                           #   #              #  #                      
2Q7X_B         7 ITVIGGGTGSPVILXSLRExd----vEIAAIVTVADDGGSSGELRxnxqqltpPGDLRNVLVAXSdxpxfyexvf----- 77  Streptococcus p...
ZP_03467777    8 IVFFSGGTALNGLAAELAKvn----pKCAYIITTFDSGGSSAALRevfd-mpaVGDVRNRLLALAdkenpdkanivella 82  Desulfovibrio s...
YP_001793068   4 IVMFGGGSGSRDITMALCRqr----yEVTRVVPAWDSGGSSRALRaalg-ilaMGDIRQALMTMAhgegrvssvvrffna 78  Leptothrix chol...
XP_001754784   1 MCVNAGGTAFNGVVEELKKwt----tRVSHVLPVSDDGGSTAEIVrvvg-gpaVGDIRSRCLRLSsdssvealavkrllg 75  Physcomitrella ...
ABR17590      60 MLVFSGGTAFNGVVEELKKvt----tRVAHVLPVSDDGGSTAEIVrvlg-gpaVGDIRSRCLRLSdestsealavrrllg 134 Sitka spruce
O22962        54 LLVFSGGTGFNGVVEELKKlt----tRVAHVLPVSDDGGSTAEIVrvlg-gpaVGDIRSRCLRLSdestsealavrrllg 128 thale cress
CAD11407       8 ITVFSGGTAANSLVDVFNGiiekkncQLNYIIPISDNGGSSSELIrfig-gpsVGDIRSRLVRLIpnpsnnqekaalkal 86  Neurospora crassa
CAG89696       8 IAVLSGGTATNELVSLFKSvs----aNITYILPISDNGGSTSELIritg-gpaIGDIRSRLTRLIpenqeplrkllsfrl 82  Debaryomyces ha...
EDN62797       3 VVVCSGGTATNSLTPCFSNisilkghELTYILPISDNGGSTSEILrivg-gpaIGDIRSRIVRLLqdeqlvelfghrlpn 81  Saccharomyces c...
CAP95316       7 IVVVSGGSAANNLVDVFSAvreskncPLSYIIPISDNGGSSSELIrifg-gpgIGDVRSRLVRLIpdspehpersaikal 85  Penicillium chr...
Feature 1                                                                             #          
2Q7X_B        78 ----------------------------------------------------qyrfsedagaFAGHPLGNLIIAGLSEXQ 105 Streptococcus p...
ZP_03467777   83 trlpryadktalygqlshla--------ngshslmdgfseivrkilsdrfalfielagdnfdPVNASLGNIVLAAGFMAH 154 Desulfovibrio s...
YP_001793068  79 rlsetssqpdllaefdfyv---------sgahpllatmepgirgailnylrvfqsniagdfdFCRGSIGNFVLTGAYFAH 149 Leptothrix chol...
XP_001754784  76 hrlsseeteakaewyeivege------hqlwdnvsgpyretiraflvhfqcqillrsvdkfsFRNGSIGNFFFAGARIFF 149 Physcomitrella ...
ABR17590     135 hrlsldplqakaewyeiiege------hvlwngvsrpyretiraflvyfqnqilrrasenfcFGNGSIGNFFFAGARIFF 208 Sitka spruce
O22962       129 hrlpidahqakkdwydivegnh---slwdgvsrpysetirafliyfqnevmltdtekhvfigFIFDHIGNFFFAGARIFF 205 thale cress
CAD11407      87 feyrlpgdpskariewldivear--hllwayisspkrelirsilntlnleivkrtrptstfnFAEASIGNMFLTGARIFS 164 Neurospora crassa
CAG89696      83 ssdpreakvqwndivdgthplwanidpstreifraffihvhgdllkrskhsfslhtnkrqfrYELANVGNLFLTGGRLFI 162 Debaryomyces ha...
EDN62797      82 dkllakkewneivegshpi---------wknisievkemcrsfiihmqaellkkikhsnpfqFESASIGNFFLTGARLFL 152 Saccharomyces c...
CAP95316      86 fnhrlpaeagiatnewqsivdgt-sglwtaitpakkelirsffnvlnleilkrarppsstfdFTSASVGNLFLTAARLFS 164 Penicillium chr...
Feature 1                                                                                        
2Q7X_B       106 gst-ynaXQLLSXFFht--tGXIYPSsd--hPLTLHAVFqDGTEVAGESHIvdh-------------------------- 154 Streptococcus p...
ZP_03467777  155 qrilappIAQLSRLIga--rGIVRAStv--dNGHLAVRLeNGEILAGQHQFtgketd----------------------- 207 Desulfovibrio s...
YP_001793068 150 grdintaIFVFRKLCai--dGHVWPSta-ddTVELRAVLrDGQVVRGQERItdlnae----------------------- 203 Leptothrix chol...
XP_001754784 150 qsldaaiFLYSRVSHip-thSLVLPAistndRLTLGCELlDGTVIKGQNAIshpttalrvvc------------------ 210 Physcomitrella ...
ABR17590     209 qsldaavFLFSRVSHip-tdSLVLPVicsndRLTLGCELwNGTVIRGQNEIshptsgavepin----------------- 270 Sitka spruce
O22962       206 qsldaaiFLFSRVSEip-cdSLVLPVistndRLTLGCELqDGTIIRGQNEIshpttgttqtvd----------------- 267 thale cress
CAD11407     165 gsfesaiYLLSMICSip-pnVSVLPAinsnfTHHISAGLeDGTTIAGQVAIshpsaptalpddvkislatpsfppllhgg 243 Neurospora crassa
CAG89696     163 gsldsaiELFSRLTGid-adTQVLPClntnfTYHITALLeNGLIITGQSQIshpsesdtkvdihpppihashpgtpqegi 241 Debaryomyces ha...
EDN62797     153 gsldasiELMMRIGRcs-plVHVIPCintnhTHHISALLtNGEMITGQSQIshpsksvpkdnsiahsakfihllgsyddh 231 Saccharomyces c...
CAP95316     165 gsfesaiYLLGSICGvpsdlVRVIPAinsnfSHHISASLaDGTVIVGQNSIshpseatafdhnsrsrrpsllladgddad 244 Penicillium chr...
Feature 1                                                                                        
2Q7X_B           --------------------------------------------------------------------------------     Streptococcus p...
ZP_03467777      --------------------------------------------------------------------------------     Desulfovibrio s...
YP_001793068     --------------------------------------------------------------------------------     Leptothrix chol...
XP_001754784     --------------------------------------------------------------------------------     Physcomitrella ...
ABR17590         --------------------------------------------------------------------------------     Sitka spruce
O22962           --------------------------------------------------------------------------------     thale cress
CAD11407     244 hghgappssanlhpaamvamamhdggiiklppqhltvpstagsssstaassssvttsqkttptkptfpslpsrpgarars 323 Neurospora crassa
CAG89696     242 ndnsesvfflrtndpahvny------------------------------------------------ndtnslvsdisd 273 Debaryomyces ha...
EDN62797     232 lkilldde------------------------------------------------------------------------ 239 Saccharomyces c...
CAP95316     245 ytdsems------------------------------------------------------------------------- 251 Penicillium chr...
Feature 1                                                                                        
2Q7X_B       155 ----------------------------------rgiIDNVYVTnalnd-----dtplASRRVVQTILESDxIVLGPGSL 195 Streptococcus p...
ZP_03467777  208 --------------------------------pisspIDGMWICsgvddp--wprpvhGSSLAINLVNNADmIVYPMGSF 253 Desulfovibrio s...
YP_001793068 204 --------------------------------qaqagIERVELLhagdgrp-aasrpaANPAVLEAIGTADlMLFGPGSF 250 Leptothrix chol...
XP_001754784 211 --------------------------rsqtssplpspIKRIFYMssegnnifhevfpaVNPAVVEQLSLVDaIVYGMGSL 264 Physcomitrella ...
ABR17590     271 -------------------------kvvssipalparIKRIFYMssegtnllhevfpaVNDTVLEQLNQVDcIVYAMGSL 325 Sitka spruce
O22962       268 -------------------------krhcstsalpskIKRVFYMssegnnllhevfppVNPTVLEQLRSVDcIVYAMGSL 322 thale cress
CAD11407     324 rtetedaslpgslpslrtqnisfsksdsdeadqlsarIERVWYInpygh----eiwpnANPKVIDALAGTTmVVYSIGSL 399 Neurospora crassa
CAG89696     274 dssdeesghvpqythpalkksqlhfnksdhiepllspIERIYYIspyge----eicptANSRVTNSLANADvIVYSIGSL 349 Debaryomyces ha...
EDN62797     240 eeeaeeeyanpiyilpelknsqlhfdkldesqnlpapVHRILYInpyge----eikpmGNPRAISKVKKADmVVYSIGSL 315 Saccharomyces c...
CAP95316     252 --dpttyeedhlpgslatlrnknikfsktenedlssrITRIWYInpygq----eirppANPRVLEAINDSQaIIYSIGSL 325 Penicillium chr...
Feature 1                                                                                        
2Q7X_B       196 FTSILPNIVIXEIGRALLEtx-----------------------------aEIAYVCNixTQRGETEh---fTDSDHVEV 243 Streptococcus p...
ZP_03467777  254 YSSMLAAISPQGLGNAISLnp-----------------------------cPKVFIPNmgFDPELIGh----SINLQVER 300 Desulfovibrio s...
YP_001793068 251 YTSTLPHLSVAGIAEAIRAapp---------------------------qvPKVFVGNilECPETIGg----TVAEQVRA 299 Leptothrix chol...
XP_001754784 265 YTSICPSLVLRGVGETIAArs-----------------------------cLKVMILNstYDRETFGm----PASAFVAS 311 Physcomitrella ...
ABR17590     326 YTSVCPSLVLNGVGEAISIts-----------------------------cLKVLLLNgsHDRETTNm----TASDFVTA 372 Sitka spruce
O22962       323 FTSICPSLVSTRNKYVVQKww----------------------------itKFVLLLNgsQDRETSRf----TASCFVTA 370 thale cress
CAD11407     400 WTSIVPSLVLRGVGEALAGeeeeeeeeeedqseegeqgqgqggmkttttttKKVLVLNatIDRETGPkskpmTATDFVRA 479 Neurospora crassa
CAG89696     350 MTSIVPIVILKGVGKAIANdiiqek---------------------ggrkkKRILLLNgvNDRETFGm----TAADFVRV 404 Debaryomyces ha...
EDN62797     316 MTSLLPILILGNLAEVILEsn----------------------------ntKKVLLINnkYDREVFGl----DGLHYVQM 363 Saccharomyces c...
CAP95316     326 YTSIIPAIILRGVGKSIVSsp----------------------------arHKILILNgsLDRETGPpsapfSASDFVEA 377 Penicillium chr...
Feature 1                                                                                        
2Q7X_B       244 LHRHlg-----------------------------------rpFIDTVLVNiexvpqeyxnsnr-------------fde 275 Streptococcus p...
ZP_03467777  301 LLEVlrmdnsa--------------------------yigseaVLNYILIDsengty----------------------- 331 Desulfovibrio s...
YP_001793068 300 LLQAgg-----------------------------------pgSLTHVLLNrgwvpferv-------------------- 324 Leptothrix chol...
XP_001754784 312 ITDAlnrtfcdsmesrnc------------ddpcpsldhspsdYITVMLVPeggdi------------------------ 355 Physcomitrella ...
ABR17590     373 ICDAlnrkhgd--------------------------slkclnNPPNTYVNvmlvpegg--------------------- 405 Sitka spruce
O22962       371 IADAlnrthgdtnirlknpt--------yidiqehhfcvqpgyYINTLLVPkdgeiavdlkqlseqgiydvvsisflhlf 442 thale cress
CAD11407     480 VADAgeq----------------------------------srRSDPTYQPrphdgqevggql---------------ar 510 Neurospora crassa
CAG89696     405 IVKSatyslses-----------------------rmtsniedVSNQIQWNkyithlfym-------------------- 441 Debaryomyces ha...
EDN62797     364 IIDSmsraiagyrqskg--------------vhsenddfewqdFITDIVYLkngei------------------------ 405 Saccharomyces c...
CAP95316     378 IVSAgeesrgrgpiihsqdqsqtpattsvqenvrnyralpytnYVTHILHLdgpgtphv--------------------- 436 Penicillium chr...
Feature 1                                                         
2Q7X_B       276 ylvqvehdfVGLCXQv-sRVISsnflrl---enggaFHDGDLIVDELXR 320 Streptococcus pneumoniae TIGR4
ZP_03467777  332 ---qeepdlAALEKFp-lKVIDrtlvs----desdgLIDPQLLAPILLE 372 Desulfovibrio salexigens DSM 2638
YP_001793068 325 akgfrylheGVLPEGg-pGLLAddfed----pwhrgRHDAPKVVELLGE 368 Leptothrix cholodnii SP-6
XP_001754784 356 ----kidveNLTRMGi-aRVVTvdstid---eklgrIYEPKALIGALQV 396 Physcomitrella patens subsp. patens
ABR17590     406 --qvpvdiqHLEAQGi-cRVIFvdsise---ekigtIFEPKSLIQVLAN 448 Sitka spruce
O22962       443 pslcaqqtlTVTSTLl-qRVVEsvgdp-----khgiLFNPSSLINTLAG 485 thale cress
CAD11407     511 tgtapkvdvKELEGLg-iKCVRvegrvq--edgkevRYDEGGLGEALEG 556 Neurospora crassa
CAG89696     442 kdpkieverEYLESEkniSCIEvkre------ehqdYYDLNDLEVKLRH 484 Debaryomyces hansenii
EDN62797     406 -----eideTIFEKHs-iRCHQiass------dkmeGEELEKALNQIGL 442 Saccharomyces cerevisiae YJM789
CAP95316     437 --drerltrMGIETLr-lYGRKimakygdedtvigmQYDPNALVQAIEV 482 Penicillium chrysogenum Wisconsin 54-1255

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap