1R4I


Conserved Protein Domain Family
NR_DBD_AR

?
cd07173: NR_DBD_AR 
Click on image for an interactive view with Cn3D
DNA-binding domain of androgen receptor (AR) is composed of two C4-type zinc fingers
DNA-binding domain of androgen receptor (AR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. To regulate gene expression, AR interacts with a palindrome of the core sequence 5'-TGTTCT-3' with a 3-bp spacer. It also binds to the direct repeat 5'-TGTTCT-3' hexamer in some androgen controlled genes. AR is activated by the androgenic hormones, testosterone or dihydrotestosterone, which are responsible for primary and for secondary male characteristics, respectively. The primary mechanism of action of ARs is by direct regulation of gene transcription. The binding of androgen results in a conformational change in the androgen receptor which causes its transport from the cytosol into the cell nucleus, and dimerization. The receptor dimer binds to a hormone response element of AR regulated genes and modulates their expression. Another mode of action of androgen receptor is independent of their interactions with DNA. The receptor interacts directly with signal transduction proteins in the cytoplasm, causing rapid changes in cell function, such as ion transport. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, AR has a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).
Statistics
?
PSSM-Id: 143547
View PSSM: cd07173
Aligned: 8 rows
Threshold Bit Score: 148.531
Threshold Setting Gi: 50513367
Created: 2-Feb-2009
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 8 residues -Click on image for an interactive view with Cn3D
Feature 1:zinc binding site [ion binding site]
Evidence:
  • Structure:1R4I_a; C4 type zinc finger of Rattus norvegicus androgen receptor, contacts at 4A
    View structure with Cn3D
  • Comment:Zinc finger, C4-type: The domain contains two groups of four Cys residues. Each group is involved in the co-ordination of a single zinc atom.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1             #  #             #  #               #     #         #  #                   
1R4I_A         5 PPQKTCLICGDEASGAHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLG--ARKL 82  Norway rat
NP_001035179 338 PPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLG--ARKL 415 chicken
ABO21344     507 PPQRTCLICSDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKLRRKNCPSCRLKKCFEVGMTLG--ARKL 584 zebrafish
Q7T1K4       412 PPQKPCLSCEDEASGCHYEALTCGSCKVFFKRAAEGNQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLG--ARKL 489 bullfrog
CAG08385       3 SERRVCMVCGDDASGCHYGAVTCGSCKVFFKRAAAGKQNHLCASRNDCTIDKLRRKNCASCRLKRCFMSGMSLKaaTRAL 82  spotted green p...
AAI70347     424 PPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLG--ARKL 501 African clawed ...
BAA75464     488 PPQRTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASINDCTIDKLRRKNCPSCRLKRCFAAGMTLG--ARKL 565 Japanese eel
AAP55843     410 QPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKHKFLCASRNDCTIDKVRRKNCPSCRLRKCFAAGMTLG--GRKL 487 spiny dogfish
Feature 1            
1R4I_A        83 KKLG 86  Norway rat
NP_001035179 416 KKLG 419 chicken
ABO21344     585 RKIG 588 zebrafish
Q7T1K4       490 KKLG 493 bullfrog
CAG08385      83 VVAI 86  spotted green pufferfish
AAI70347     502 KKLG 505 African clawed frog
BAA75464     566 KKIG 569 Japanese eel
AAP55843     488 KNTR 491 spiny dogfish

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap