1R4R,1R4O,1R4R,3G9P,3G6T,2C7A


Conserved Protein Domain Family
NR_DBD_GR_PR

?
cd07172: NR_DBD_GR_PR 
Click on image for an interactive view with Cn3D
DNA-binding domain of glucocorticoid receptor (GR) is composed of two C4-type zinc fingers
DNA-binding domains of glucocorticoid receptor (GR) and progesterone receptor (PR) are composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinate a single zinc atom. The DBD from both receptors interact with the same hormone response element (HRE), which is an imperfect palindrome GGTACAnnnTGTTCT, upstream of target genes and modulates the rate of transcriptional initiation. GR is a transcriptional regulator that mediates the biological effects of glucocorticoids and PR regulates genes controlled by progesterone. GR is expressed in almost every cell in the body and regulates genes controlling a wide variety of processes including the development, metabolism, and immune response of the organism. PR functions in a variety of biological processes including development of the mammary gland, regulating cell cycle progression, protein processing, and metabolism. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, GR and PR have a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a non-conserved hinge and a C-terminal ligand binding domain (LBD).
Statistics
?
PSSM-Id: 143546
View PSSM: cd07172
Aligned: 20 rows
Threshold Bit Score: 126.869
Threshold Setting Gi: 227343768
Created: 2-Feb-2009
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 8 residues -Click on image for an interactive view with Cn3D
Feature 1:zinc binding site [ion binding site]
Evidence:
  • Structure:1R4R_A; C4 type zinc finger of Rattus norvegicus Glucocorticoid Receptor, contacts determined by 4A
    View structure with Cn3D
  • Comment:Zinc finger, C4-type: The domain contains two groups of four Cys residues. Each group is involved in the coordination of a single zinc atom.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1         #  #             #  #               #     #         #  #                  
1R4R_A      3 PARPCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQAGMNLEARKTK 80   Norway rat
P08235    599 PSKICLVCGDEASGCHYGVVTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRLQKCLQAGMNLGARKSK 676  human
XP_532685 596 PSKICLVCGDEASGCHYGVVTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPVCRLQKCLLAGMKFRTRKSK 673  dog
ABD46745   27 PSKVCLVCADEASGCHYGVLTCGSCKVFFKRAVEGQQNYLCAGRNDCIIDKIRRKNCPACRLRKWLNAGMNLGARKSK 104  little skate
AAK20930   64 PQKACLICSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRLRKCIQAGMTLGARKLK 141  sea lamprey
ABD46742  233 PHKACLICRDEASGCHYGVLTCGSCKVFFKRAIEGQHNYLCAGRNDCIIDKIRRKNCPACRLRKCIQAGMMLGARKMK 310  Atlantic hagfish
CAQ14518  183 SQRQCVICGDEASGCHYGVLTCGSCKVFFKRAVEGHHNYLCAGRNDCIVDKIRRKNCPACRLRKCYQAGMMLGGRKMK 260  zebrafish
BAB85993  319 SQKFCLICGDEASGCHYGVLTCGSCKVFYKRAVEGHQNYLCAGRNDCIVDKIRRKNCPACRLRKCYQAGMTLGGRKMK 396  Japanese eel
ABD46743  239 LQKLCLICGDEASGCHYGVITCGSCKVFFKRASEGHNNYLCAGRNDCIIDKMRRKNCPACRLRKCCHAGMVLGAHRSK 316  Atlantic hagfish
NP_990593 417 PQKICLICGDEASGCHYGVLTCGSCKVFFKRAMEGQHNYLCAGRNDCIVDKIRRKNCPACRLRKCCQAGMVLGGRKFK 494  chicken

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap