1LO1


Conserved Protein Domain Family
NR_DBD_ERR

?
cd07170: NR_DBD_ERR 
Click on image for an interactive view with Cn3D
DNA-binding domain of estrogen related receptors (ERR) is composed of two C4-type zinc fingers
DNA-binding domain of estrogen related receptors (ERRs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. ERR interacts with the palindromic inverted repeat, 5'GGTCAnnnTGACC-3', upstream of the target gene and modulates the rate of transcriptional initiation. The estrogen receptor-related receptors (ERRs) are transcriptional regulators, which are closely related to the estrogen receptor (ER) family. Although ERRs lack the ability to bind to estrogen and are so-called orphan receptors, they share target genes, co-regulators and promoters with the estrogen receptor (ER) family. By targeting the same set of genes, ERRs seem to interfere with the classic ER-mediated estrogen response in various ways. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, ERR has a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a non-conserved hinge and a C-terminal ligand binding domain (LBD).
Statistics
?
PSSM-Id: 143544
View PSSM: cd07170
Aligned: 8 rows
Threshold Bit Score: 173.892
Threshold Setting Gi: 30749423
Created: 2-Feb-2009
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
zinc bindingDNA binding
Conserved site includes 8 residues -Click on image for an interactive view with Cn3D
Feature 1:zinc binding site [ion binding site]
Evidence:
  • Structure:1LO1_A, Zinc binding site of Estrogen Related Receptor 2 Dna Binding Domain, defined by 3.5A contacts
    View structure with Cn3D
  • Comment:Zn finger, C4-type: The domain contains two groups of four Cys residues. Each group is involved in the coordination of a single zinc atom

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1              #  #             #  #               #     #         #  #                  
1LO1_A         1 XIPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKALKVGMLKEGVRLD 80  human
NP_001007082  99 SMPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLD 178 chicken
NP_648183    121 DELRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQGNIEYTCPANNECEINKRRRKACQACRFQKCLLMGMLKEGVRLD 200 fruit fly
NP_001071700 170 TPPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGSIDYTCPAANDCEITKRRRKSCQSCRFSKCLRVGMLREGVRLD 249 Ciona intestinalis
ABI97120      83 DELKRLCLVCGDVASGYHYGVSSCEACKAFFKRTIQGNIEYSCPASGECEITKRRRKACQACRFQKCLRVGMLREGVRLD 162 Marisa cornuari...
AAS66635       4 SIPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLD 83  zebrafish
NP_001087382  64 SIPKRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGNIEYSCPASNECEITKRRRKACQACRFTKCLRVGMLKEGVRLD 143 African clawed ...
AAS46731      46 TIHKPLYIMCQDIASGYHYRVASYKACKTFFKRTIQGNIKYSCPATNKCEITKQRRKFCQVCQFRKCLKVGMLKKSVHAD 125 Norway rat
Feature 1                         
1LO1_A        81 RVRGGRQKYKRRLDSEN 97  human
NP_001007082 179 RVRGGRQKYKRRIDAEN 195 chicken
NP_648183    201 RVRGGRQKYRRNPVSNS 217 fruit fly
NP_001071700 250 RVRGGRQKYKRKIDANE 266 Ciona intestinalis
ABI97120     163 RVRGGRQKYKRSIDNQS 179 Marisa cornuarietis
AAS66635      84 RVRGGRQKYKRRMDAEN 100 zebrafish
NP_001087382 144 RVRGGRQKYKRRPDGDI 160 African clawed frog
AAS46731     126 QVLGGGQKYKGQLDLEK 142 Norway rat

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap