Conserved Protein Domain Family
NR_DBD_DHR4_like

?
cd07168: NR_DBD_DHR4_like 
DNA-binding domain of ecdysone-induced DHR4 orphan nuclear receptor is composed of two C4-type zinc fingers
DNA-binding domain of ecdysone-induced DHR4 orphan nuclear receptor is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. This domain interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. Ecdysone-induced orphan receptor DHR4 is a member of the nuclear receptor family. DHR4 is expressed during the early Drosophila larval development and is induced by ecdysone. DHR4 coordinates growth and maturation in Drosophila by mediating endocrine response to the attainment of proper body size during larval development. Mutations in DHR4 result in shorter larval development which translates into smaller and lighter flies. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, DHR4 has a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).
Statistics
?
PSSM-Id: 143542
View PSSM: cd07168
Aligned: 5 rows
Threshold Bit Score: 184.685
Threshold Setting Gi: 219462256
Created: 2-Feb-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
zinc bindingputative DNA
Feature 1:zinc binding site [ion binding site]
Evidence:
  • Comment:Zinc finger, C4-type: The domain contains two groups of four Cys residues. Each group is involved in the co-ordination of a single zinc atom.
  • Comment:contacts derived from related proteins

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                 #  #             #  #               #      #         #  #               
NP_001033823  913 DEDEQPLVCMICEDKATGLHYGIITCEGCKGFFKRTVQNRRVYTCV-ADGTCEITKAQRNRCQYCRFKKCIEQGMVLQAV 991  fruit fly
EEC19235       98 DEDEQPMVCMICEDKATGLHYGIITCEGCKGFFKRTVQNKRVYTCV-ADGNCEITKAQRNRCQYCRFQKCLRQGMVLAAV 176  black-legged ...
NP_001020384  263 DEDESLMLCSICCDKATGLHYGIITCEGCKGFFKRTVQNKRVYTCV-GNGQCEVTKAQRNRCQYCRFQKCLHMGMMLEAV 341  purple urchin
AAG15181       93 VSKSSSKLCSVCGDKSTGLHYGAATCEGCKGFFKRSVQNKKVYHCS-QDNCCEIDKQNRNRCQSCRFRKCISKGMLTEAV 171  nematode
XP_002228838  853 EHVRVEKLCVVCRDKASGLHYGAMACEGCKGFFKRTVQNRRLYACVrGEYRCEVVMEKRNLCQGCRLRRCMRKGMMIAAV 932  Florida lancelet
Feature 1                    
NP_001033823  992 REDRMPGGRNS 1002 fruit fly
EEC19235      177 REDRMPGGRNS 187  black-legged tick
NP_001020384  342 REDRMPGGRNT 352  purple urchin
AAG15181      172 REDRMPGGRNG 182  nematode
XP_002228838  933 REDRVPGGRLK 943  Florida lancelet

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap