Conserved Protein Domain Family
NR_DBD_PNR_like_1

?
cd07164: NR_DBD_PNR_like_1 
DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like proteins is composed of two C4-type zinc fingers
DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like proteins is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. PNR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. PNR is a member of nuclear receptor superfamily of the ligand-activated transcription factors. PNR is expressed only in the outer layer of retinal photoreceptor cells. It may be involved in the signaling pathway regulating photoreceptor differentiation and/or maintenance. It most likely binds to DNA as a homodimer. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, PNR has a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).
Statistics
?
PSSM-Id: 143538
View PSSM: cd07164
Aligned: 12 rows
Threshold Bit Score: 120.647
Threshold Setting Gi: 215503353
Created: 2-Feb-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
zinc bindingputative DNA
Feature 1:zinc binding site [ion binding site]
Evidence:
  • Comment:Zinc finger, C4-type: The domain contains two groups of four Cys residues. Each group is involved in the co-ordination of a single zinc atom.
  • Comment:Coordinating residues derived by comparison to related proteins

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1        #  #             #  #               #     #         #  #                      
XP_002236522   3 CRICGDRSSGKHYGVYSCDGCRGFFKRSIRRNLAYICKENGSCVVDVARRNQCQACRFKKCLDAQMNKDGFRQCNHLL 80  Florida lancelet
EEC12847      18 CRVCGDRASGRHYGVASCDGCRGFFKRSVRRQLQYVCKEGGACVVDVARRNQCQACRLAKCLRAAMRPEGEAPKPLVS 95  black-legged tick
XP_973111     17 CRVCGDKASGKHYGVSSCDGCRGFFKRSIRRNLEYVCKENGRCIVDVTRRNQCQACRFKKCLQVNMKRDAVQHERAPR 94  red flour beetle
XP_001634999   4 CRVCGDRASGKHYGVMTCDGCRGFFKRSVRRNLAYQCKEKNDCPIDVARRNQCQACRLRKCFEMNMNRDAVQHERAPR 81  starlet sea anemone
XP_002224193 150 CRICGDRSSGKHYGVYSCDGCRGFFKRSIRRNLAYICKENGSCVVDVARRNQCQACRFKKSVQHERAPRCYQYRRDDS 227 Florida lancelet
XP_001624815   1 CRVCGDRSSGKHYGVFTCDGCRGFFKRSIRRNLTYHCKELGKCVVDVARRNQCQACRLKKCFEVQMNKDAVQHERAPR 78  starlet sea anemone
XP_624042     19 CKVCGDKASGKHYGVPSCDGCRGFFKRSIRRNLDYVCKENGRCIVDVSRRNQCQACRFTKCLQVNMKRDAVQHERAPR 96  honey bee
EEB17932       9 CKVCGDKASGKHYGVISCDGCRGFFKRSIRRGLAYHCKESNSCIVDVTRRNQCQACRFKKCLSVNMKRDAVQHERSPR 86  human body louse
XP_002154441  24 CRVCGDKSSGRHYGVFTCDGCRGFFKRAVRRNLLFLCKENGNCQVDVARRNQCQACRLRKCYDVHMNRDAVQHERSPR 101 green hydra
CAO79103      16 CKVCGDRASGKHYGVPSCDGCRGFFKRSIRRNLEYVCKEGGKCVVDVSRRNQCQACRFAKCLQANMRREAVQHERAPR 93  yellow fever mosq...
XP_002156561  35 CRICGDRSSGRHYGVPSCDGCRGFFKRSVRRNVSYACKFQGECVIDLKRRNQCQFCRYQRCLKVGMNKNAVQHERQPK 112 green hydra
XP_001677161  12 CRVCGDRASGRHYGVLSCDGCRGFFKRSIRRNLRYTCKEAKRCVIDVVRRNQCQSCRFQKCLAVSMNRHAVQHERLDT 89  Caenorhabditis br...

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap