Conserved Protein Domain Family
NR_DBD_TLX

?
cd07163: NR_DBD_TLX 
DNA-binding domain of Tailless (TLX) is composed of two C4-type zinc fingers
DNA-binding domain of Tailless (TLX) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. TLX interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. TLX is an orphan receptor that is expressed by neural stem/progenitor cells in the adult brain of the subventricular zone (SVZ) and the dentate gyrus (DG). It plays a key role in neural development by promoting cell cycle progression and preventing apoptosis in the developing brain. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, TLX has a central well conserved DNA-binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).
Statistics
?
PSSM-Id: 143537
View PSSM: cd07163
Aligned: 13 rows
Threshold Bit Score: 195.793
Threshold Setting Gi: 17541682
Created: 3-Feb-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
zinc bindingputative DNA
Feature 1:zinc binding site [ion binding site]
Evidence:
  • Comment:Zinc finger, C4-type: The domain contains two groups of four Cys residues. Each group is involved in the coordination of a single zinc atom.
  • Comment:Coordination residues derived from related proteins

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                 #  #             #  #               #          #         #  #          
NP_990501      8 TSRIL-DIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTYVCKSGN---QGGCPVDKTHRNQCRACRLKKCLEVNM 83  chicken
XP_794533     11 SSRIL-DIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTYVCKNRSg--GGPCPVDKTHRNQCRACRLKKCLQVDM 87  purple urchin
AAL29193      21 NGRLL-DIPCKVCGDRSSGKHYGIYACDGCSGFFKRSIRRNRSYTCRATNg--KGNCPVDKIHRNQCRSCRLKKCFEVTM 97  Acropora millepora
NP_502094     13 SRILL-DVDCRVCEDHSSGKHYSIFSCDGCAGFFKRSIRRHRQYVCKNKGspsEGQCKVDKTHRNQCRACRLRKCLEIGM 91  nematode
NP_001079280   8 TSRIL-DIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRSYVCKSGN---QGGCPVDKTHRNQCRACRLKKCLEVNM 83  African clawed ...
NP_001003608  19 SSRIL-DIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTYVCKSGT---QGGCPVDKTHRNQCRACRLKKCLEVNM 94  zebrafish
BAD18677      45 GGRIL-DIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTYVCKSGN---QGGCPVDKTHRNQCRACRLKKCLEVNM 120 human
XP_789465     47 SDRLL-DIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIHRGRVYVCKQQGk-gGGDCPIDKTHRNQCRACRLRKCFEAQM 124 purple urchin
NP_477140      5 GDRLL-DIPCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRIYTCKATGd-lKGRCPVDKTHRNQCRACRLAKCFQSAM 82  fruit fly
XP_001945915  17 NSRILyDIPCKVCKDFSSGKHYGIYACDGCAGFFKRSIRRNRQYICKSKS---EGACPVDKTHRNQCRACRLRKCMLSGM 93  pea aphid
NP_001034502  30 SSRIL-DIPCKVCGDFSSGKHYNIFACDGCAGFFKRSIRRNRQYVCKAKD---EGSCIIDKTHRNQCRACRLKKCQNVGM 105 red flour beetle
XP_002237802   1 SGRIL-DIPCKVCGDRSSGKHYGVYTCDGCSGFFKRSIRHNRNYTCKSPS---SAPCPVDKSRRNQCRACRLQRCFQVNM 76  Florida lancelet
P18102        25 SSRILyHVPCKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQYVCKSQK---QGLCVVDKTHRNQCRACRLRKCFEVGM 101 fruit fly
Feature 1                        
NP_990501     84 NKDAVQHERGPRTSTI 99  chicken
XP_794533     88 NKDAVQHERGPRNSTI 103 purple urchin
AAL29193      98 NKDAVQHERGPRSSTL 113 Acropora millepora
NP_502094     92 NKDAVQHERGPRNSSL 107 nematode
NP_001079280  84 NKDAVQHERGPRTSTI 99  African clawed frog
NP_001003608  95 NKDAVQHERGPRTSTI 110 zebrafish
BAD18677     121 NKDAVQHERGPRTSTI 136 human
XP_789465    125 NKDAVQHERGPRKPKN 140 purple urchin
NP_477140     83 NKDAVQHERGPRKPKL 98  fruit fly
XP_001945915  94 NKDAVQHERGPRTSTV 109 pea aphid
NP_001034502 106 NKDAVQHERGPRNSTL 121 red flour beetle
XP_002237802  77 NKDAVQHERGPRNSTI 92  Florida lancelet
P18102       102 NKDAVQHERGPRNSTL 117 fruit fly

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap