2O2Q,2O2R


Conserved Protein Domain Family
ALDH_F1L_FTFDH

?
cd07140: ALDH_F1L_FTFDH 
Click on image for an interactive view with Cn3D
10-formyltetrahydrofolate dehydrogenase, ALDH family 1L
10-formyltetrahydrofolate dehydrogenase (FTHFDH, EC=1.5.1.6), also known as aldehyde dehydrogenase family 1 member L1 (ALDH1L1) in humans, is a multi-domain homotetramer with an N-terminal formyl transferase domain and a C-terminal ALDH domain. FTHFDH catalyzes an NADP+-dependent dehydrogenase reaction resulting in the conversion of 10-formyltetrahydrofolate to tetrahydrofolate and CO2. The ALDH domain is also capable of the oxidation of short chain aldehydes to their corresponding acids.
Statistics
?
PSSM-Id: 143458
View PSSM: cd07140
Aligned: 10 rows
Threshold Bit Score: 968.117
Threshold Setting Gi: 133930964
Created: 2-Jan-2009
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 25 residues -Click on image for an interactive view with Cn3D
Feature 1:NADP binding site [chemical binding site]
Evidence:
  • Structure:2O2Q: rat 10'formyltetrahydrofolate dehydrogenase in complex with NADP+, defined using 3.5 A.
    View structure with Cn3D
  • Structure:2O2R: rat 10'formyltetrahydrofolate dehydrogenase in complex with NADPH, defined using 3.5 A.
    View structure with Cn3D
  • Comment:FTHFDH binds the 2'-phosphate group of NADP via a water-mediated contact with Gln600 that may contribute to the specificity of the enzyme for NADP over NAD.
  • Comment:When reduced, the nicotinamide ring of NADP is displaced from the active site, restoring the contact between Cys707 and Glu673 and allowing the latter to activate the hydrolytic water molecule in deacylation.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                         
2O2Q_A         32 TLQMPYQLFIGGEFVDAEGSKTYNTINPTDGSVICQVSLaqvsDVDKAVAAAKEAFENGlwgkINARDRGRLLYRLADVM 111  Norway rat
2O2R_A         32 TLQMPYQLFIGGEFVDAEGSKTYNTINPTDGSVICQVSLaqvsDVDKAVAAAKEAFENGlwgkINARDRGRLLYRLADVM 111  Norway rat
CAF89773      517 TVKMPNQCFINGRFEDAESGKTYNTVNPSDGSVICNVSYasvgDVDRAVAAAKEAYDNGpwgkMNPRDRGSLLYRLADLM 596  spotted green...
Q6GNL7        417 TVKIPHQLFINGQFMDAEGGKSYDTINPTDGTAICKVSLaqisDIDRAVAAAKEAFENGewgkMNPRDRGRLLYRLADLM 496  African clawe...
XP_416314     438 TVNMPYQCFINGQFVNADDGKTYDTINPTDGSVIASVSSaslaDVDRAVAAAKEAFENGewgrMNARERGRLMYKLADLM 517  chicken
XP_002130073  436 VLQMPHQLFINNEFVDAANGDEYNTINPADESVICKVSKatveDVDEAVEAAKEAFEVGpwstMNPRDRGEMMFKLANLM 515  Ciona intesti...
XP_002111368  436 DVKIPHQLFINNQFVDSISGKFFKTINPTDESVICKVSYateeDVNVAVQAAKEAFEGDwg-kMNARDRGKLMYRLADLM 514  Trichoplax ad...
XP_001638214  389 TIHMPHQLFINGEFVDSHHGKTFNTINPTDGTVLAQVSLatheDVDDAVDAAKEAFYNGpwgsMNARDRATLMNRLADLM 468  starlet sea a...
NP_610107     428 EIRVPTQLFINGEFVDAEAQRTLEIVNPTNEEVLCKVACasatDVDKAVRAAHSAFYGSwr-qITPRQRGQLMLNLADLM 506  fruit fly
NP_502054     423 ELKFPHDQFIDGKFVGSSDGRTFKTINPATEKPICELPLatvaDVDRAVRAAKKAFERGewrqMSARERGKRLYKLAELM 502  nematode
Feature 1                                                                                  ## ##  
2O2Q_A        112 EQHQEELATIEALDAGAVYTLALKTHVGMSIQTFRYFAGWCDKIQGATIPINqARPNRNLTLTKKEPVGVCGIVIPWNYP 191  Norway rat
2O2R_A        112 EQHQEELATIEALDAGAVYTLALKTHVGMSIQTFRYFAGWCDKIQGATIPINqARPNRNLTLTKKEPVGVCGIVIPWNYP 191  Norway rat
CAF89773      597 EEHQEELATIETIDSGAVYTLALKTHVGMSIQTFRYFAGWCDKIQGKTIPINqARPNRNLTFTKKEPLGVCAIVIPWNYP 676  spotted green...
Q6GNL7        497 EEHQEELATIESIDSGAVYTLALKTHVGMSIQTFRYFAGWCDKIQGRTIPINqARPNRNLTFTRREPIGVCGIVIPWNYP 576  African clawe...
XP_416314     518 EEHQEELATIESIDSGAVYTLALKTHIGMSVQTFRYFAGWCDKIQGATIPINqARPNHNLTFTKKEPIGVCAIVIPWNYP 597  chicken
XP_002130073  516 EEHQEELAMIESIDSGAVYTLALKTHVGMSIQTFRYFAGWCDKIHGKTIPINqAHPNRNLTYTKREPIGVCAIVIPWNYP 595  Ciona intesti...
XP_002111368  515 EEHLEELATIETLDSGAVYTLALKTHIGMSIDTFRYFAGYCDKIHGKTIPINnARPSHNLCLTRREPLGVCGIVIPWNYP 594  Trichoplax ad...
XP_001638214  469 EQHKEELATIESLDSGAVYTLALKTHVGMSIDTVRYFAGWCDKIQGLTVPVNnAKPNRNLCYTKREPIGVCGLIVPWNYP 548  starlet sea a...
NP_610107     507 ERNKEELATIESVDSGAVYTLALKTHVGMSIEAWRYFAGWCDKIQGNTIPVNpARPNNVLTFTRKEPIGVCGLITPWNYP 586  fruit fly
NP_502054     503 EEHKEELATLESLDAGAVYTLALKTHVGMSIDVWRYFAGWCDKIQGKTIPISnARPNKNLCLTLREPIGVVGLITPWNYP 582  nematode
Feature 1                             #  #                            ##   ##            ####  #  
2O2Q_A        192 LMMLSWKTAACLAAGNTVVIKPAQVtPLTALKFAELTLKAGIPKGVVNILPGSGslvGQRLSDHPDVRKIGFTGSTEVGK 271  Norway rat
2O2R_A        192 LMMLSWKTAACLAAGNTVVIKPAQVtPLTALKFAELTLKAGIPKGVVNILPGSGslvGQRLSDHPDVRKIGFTGSTEVGK 271  Norway rat
CAF89773      677 LMMLAWKSAACLAAGNTLVLKPAQVtPLTALKFAELSVKAGIPKGVINILPGSGgmvGQRLSEHPDVRKLGFTGSTPIGK 756  spotted green...
Q6GNL7        577 LMMLAWKTAACLTAGNTVVLKPAQVtPLTALKFAELSVKAGIPKGVINILPGAGsliGQRLSDHPDVRKIGFTGSTPIGK 656  African clawe...
XP_416314     598 LMMLAWKSAACLAAGNTLVLKTAQVtPLTALKFAELSAKAGFPKGVINILPGSGglvGQHLSKHPDVRKVGFTGSTPTGK 677  chicken
XP_002130073  596 LMMLAWKMASCLAAGNTMVLKPAQVtPLTALKFAELVVKAGFPKGVINILPGAGsniGQRLADHPDIRKLGFTGSTPIGK 675  Ciona intesti...
XP_002111368  595 LMMLAWKMSSCLAAGNTCVLKPAEVtPLSALKFAELTVKAGFPKGVINILPGSGrvcGQAICDHPDIRKVGFTGSTPIGR 674  Trichoplax ad...
XP_001638214  549 LMMLAWKISPLLAAGNTVVLKPAQVtPMTALKFAELAARAGFPKGVINILPGSGsvvGNRICEHPDVRKLGFTGSTPVGK 628  starlet sea a...
NP_610107     587 LMMLSWKMAACIAAGNTCLIKPAQTcPLTALKFAELTVRAGFPPGVINVLPGKGsdaGQAVADHELVRKLGFTGSTPIGK 666  fruit fly
NP_502054     583 LMMLSWKMAACLAAGNTVVHKPAQVtPLTALKFAELSVLAGIPPGVINIVTGSGslvGNRLTAHPDVRKIGFTGSTEIGA 662  nematode
Feature 1         ##              ###                               #                             
2O2Q_A        272 HIMKSCAlsNVKKVSLELGGKSPLIIFADCDLNKAVQMGMSSVFFNKGENCIAAGRLFVEeSIHNQFVQKVVEEVEKMKI 351  Norway rat
2O2R_A        272 HIMKSCAlsNVKKVSLELGGKSPLIIFADCDLNKAVQMGMSSVFFNKGENCIAAGRLFVEeSIHNQFVQKVVEEVEKMKI 351  Norway rat
CAF89773      757 QIMKSCAvsNLKKVSLELGGKSPLIIFRDCDMDKAVRMGMSSVYFNKGENCIAAGRLFVEeSIHDEFISRVVEEIKKMKI 836  spotted green...
Q6GNL7        657 QIMKSCAvsNVKKVSLELGGKSPLIIFHDCDLDKAVRMGMSSVFFNKGENCIAAGRLFLEeSIHDEFVKRVVEEVKKMKI 736  African clawe...
XP_416314     678 EIMKSAAt-NLKKVSLELGGKSPLIIFNDCELDKAVKMGMGAVYFNKGENCIAAGRLFVEeSIHDEFVRKVVEEIKKMKI 756  chicken
XP_002130073  676 QIMKSAAvsNLKKVSLELGGKSPLIIFSDCDMDKAVRFGMSSVFFNKGENCIAAGRLFVEdSIHDEFVARIIEEIKKMKI 755  Ciona intesti...
XP_002111368  675 TVMKSAAesNLKKVSLELGGKSPLIIFQDCDMDKAVRQGMLSSLFNKGENCIAAGRIFVEeSIHDEYVARLVEEVKKLKI 754  Trichoplax ad...
XP_001638214  629 AIMESCAtsNLKKCSLELGGKSPLIIFSDCDMERAVRQGMMACLFNKGENCIAAGRLFVEeSIHDEFVNRLVDELKKLKI 708  starlet sea a...
NP_610107     667 HIMKSCAdsNLKKCSLELGGKSPLIIFADCDMDKAVKHGMSSVFFNKGENCIAAGRLFVEdRIHDEFIRRVLKDLRTMTI 746  fruit fly
NP_502054     663 TVMESCAksNIKKVSLELGGKSPLIIFADADLEKAVKQACGAVFFNKGENCIAAGRVFIAkSIHDDFVKKLVEEAKQYQI 742  nematode
Feature 1                                                                             # #         
2O2Q_A        352 GNPLERDTNHGPQNHEAHLRKLVEYCQRGVKEGATLVCGGNQvp-rpGFFFQPTVFTDVeDHMYIAKEESFGPIMIISRF 430  Norway rat
2O2R_A        352 GNPLERDTNHGPQNHEAHLRKLVEYCQRGVKEGATLVCGGNQvp-rpGFFFQPTVFTDVeDHMYIAKEESFGPIMIISRF 430  Norway rat
CAF89773      837 GDPLDRSTDHGPQNHKAHLDKLLEYCEVGVKEGATLVYGGRQvd-rpGFFMEPTVFTDVeDHMFIAKEESFGPVMVVSKF 915  spotted green...
Q6GNL7        737 GDPLDRSTDHGPQNHKAHLDKLIEYCQTGVKEGGKLVYGGKQve-rpGFFFEPTIFTDVtDEMFIAKEESFGPVMIISKF 815  African clawe...
XP_416314     757 GDPLDRSTDHGPQNHKAHLEKLLKYCETGVKEGATLVYGGRQvr-rpGYFMEPTVFTDVeDHMYIAQEESFGPVMVISKF 835  chicken
XP_002130073  756 GDPLSASTDHGPQNHKAHLDKLVEYCDVAVKEGATLTYGGKQcd-mpGLYMMPTVITDVqDHMYVAKEESFGPIMVVSKF 834  Ciona intesti...
XP_002111368  755 GDPFDRSTAHGPQNHEKHMVKLLEYVDQAVAEGATLVYGGKRld-rsGFFMEPAVLTNVaDDNYAAIEESFGPVLVISSF 833  Trichoplax ad...
XP_001638214  709 GDPLDTATDHGPQNHKAHLDSLVEYVKRGVEEGAKLVYGGRHld-rpGFFFEPAVFTNVeDDMFIAKEESFGPVVIISKF 787  starlet sea a...
NP_610107     747 GDPLDRSTAHGPQNHKAHFDKLLEFCRRGVDEGAKLVYGGCRvpnlkGYFFTPTVFTNVtDDMFIAQEESFGPIMIISKF 826  fruit fly
NP_502054     743 GDPLDRSTAHGPQNHLAHLNKLVEYVEKAVAGGAKVEVGGKRle-reGLYFPPTILSNIdDENFAASEESFGPIMCVSSF 821  nematode
Feature 1                           #                                     #                       
2O2Q_A        431 ADGDVDAVLSRANATEFGLASGVFTRDINKALYVSDKLQAGTVFINTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRI 510  Norway rat
2O2R_A        431 ADGDVDAVLSRANATEFGLASGVFTRDINKALYVSDKLQAGTVFINTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRI 510  Norway rat
CAF89773      916 QDGDVEGVLQRANDTEYGLASGVFTRDINKAMYVSERLEAGTVFVNTYNKTDVASPFGGFKQSGFGKDLGEDALMEYLKT 995  spotted green...
Q6GNL7        816 NDGDIDGVLKRANDSEFGLASGVFTKDINKALYVSEKLQAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEEALNEYLKT 895  African clawe...
XP_416314     836 KNGDIDGVLQRANTTEYGLASGVFTKDISKALYISEKLEAGTVFINTYNKTDVAAPFGGFKQSGFGKDLGEEALHEYLRT 915  chicken
XP_002130073  835 PDGDVDGVLKRANDTEYGLASGVFTKDISKALYVSDKLDAGTVFVNTYNKTDVASPFGGFKQSGFGKDLGEDALNEYLKT 914  Ciona intesti...
XP_002111368  834 KDGDVDGVLKRANKTEYGLASGVFTKDINKALLCSEKLDAGTVFVNTYNKTDVASPFGGFKQSGFGKDLGEEALNEYLKT 913  Trichoplax ad...
XP_001638214  788 DDGDVEGVLESANGTEYGLASGVFTKDMSKALRVADALEAGTCFVNTYNKTDVAAPFGGCKQSGFGKDLGMEALNEYLKT 867  starlet sea a...
NP_610107     827 NGSDIDSLMQRANRTEYGLASGVFTKDIGKALNFADRIEAGTVFVNVYNKTDVAAPFGGFKQSGYGKDLGQEALNEYLKT 906  fruit fly
NP_502054     822 DDDDIEDVLRRANDTEFGLAAGVFTRDSSKSLRVAEALHAGTVFVNTYQKTDVAAPFGGFKQSGFGKDMGEEALNEYLVT 901  nematode
Feature 1                
2O2Q_A        511 KTVTFEY 517  Norway rat
2O2R_A        511 KTVTFEY 517  Norway rat
CAF89773      996 KAVTVEY 1002 spotted green pufferfish
Q6GNL7        896 KAVTIEY 902  African clawed frog
XP_416314     916 KAVTVEY 922  chicken
XP_002130073  915 KAVTLEY 921  Ciona intestinalis
XP_002111368  914 KTVTIEY 920  Trichoplax adhaerens
XP_001638214  868 KVITIEY 874  starlet sea anemone
NP_610107     907 KCVTVEY 913  fruit fly
NP_502054     902 KTITIEY 908  nematode

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap