Conserved Protein Domain Family

cd07137: ALDH_F3FHI 
Plant aldehyde dehydrogenase family 3 members F1, H1, and I1 and related proteins
Aldehyde dehydrogenase family members 3F1, 3H1, and 3I1 (ALDH3F1, ALDH3H1, and ALDH3I1), and similar plant sequences, are in this CD. In Arabidopsis thaliana, stress-regulated expression of ALDH3I1 was observed in leaves and osmotic stress expression of ALDH3H1 was observed in root tissue, whereas, ALDH3F1 expression was not stress responsive. Functional analysis of ALDH3I1 suggest it may be involved in a detoxification pathway in plants that limits aldehyde accumulation and oxidative stress.
PSSM-Id: 143455
Aligned: 8 rows
Threshold Bit Score: 757.714
Threshold Setting Gi: 115459684
Created: 1-Jan-2009
Updated: 2-Oct-2020
Aligned Rows:
NAD(P) bindingcatalytic
Feature 1:NAD(P) binding site [chemical binding site]
  • Comment:based on similarity to structure 1AD3, class 3 rat liver aldehyde dehydrogenase (ALDH3A1)
  • Citation:PMID 9095201

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                        
Feature 1                                     ###                         #                      
Feature 1              #                 #                                                       
Feature 1                                                         # ##  #                        
Feature 1                            # #                                                         
Feature 1                                             
XP_001764841 414 HFLNPGLPFGGVGESGMSSYHGKFSFDAFSHKKAVLY 450 Physcomitrella patens subsp. patens
XP_001757163 401 QFIIPELPFGGVGESGTGAYHGKATFDAFSHRKAVLV 437 Physcomitrella patens subsp. patens

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap