Conserved Protein Domain Family
ALDH_F3FHI

?
cd07137: ALDH_F3FHI 
Plant aldehyde dehydrogenase family 3 members F1, H1, and I1 and related proteins
Aldehyde dehydrogenase family members 3F1, 3H1, and 3I1 (ALDH3F1, ALDH3H1, and ALDH3I1), and similar plant sequences, are in this CD. In Arabidopsis thaliana, stress-regulated expression of ALDH3I1 was observed in leaves and osmotic stress expression of ALDH3H1 was observed in root tissue, whereas, ALDH3F1 expression was not stress responsive. Functional analysis of ALDH3I1 suggest it may be involved in a detoxification pathway in plants that limits aldehyde accumulation and oxidative stress.
Statistics
?
PSSM-Id: 143455
View PSSM: cd07137
Aligned: 8 rows
Threshold Bit Score: 757.714
Threshold Setting Gi: 115459684
Created: 1-Jan-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
NAD(P) bindingcatalytic
Feature 1:NAD(P) binding site [chemical binding site]
Evidence:
  • Comment:based on similarity to structure 1AD3, class 3 rat liver aldehyde dehydrogenase (ALDH3A1)
  • Citation:PMID 9095201

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                        
Q70E96         8 VEESLREMRETFASGRTRSLKWRKAQIGAIYEMVKDNEDKICNALFQDLGKhstEAFRDELGVVLRTATVAINCLDKWAV 87  thale cress
Q70DU8        12 ASNLVTELRRSFDDGVTRGYEWRVTQLKKLMIICDNHEPEIVAALRDDLGKpelESSVYEVSLLRNSIKLALKQLKNWMA 91  thale cress
ABK24239       4 AVRVVRKLRYTFSSGRTRSYEWRIAQLKQVWKLVDENEDQIIEALSEDIGKppfESFFAEISLTKDSCKVAIKQLKSWMA 83  Sitka spruce
XP_001764841  19 LPRLVTEVREAYRNGRTRPAAWRVQQLNGIIRMISERESEIVQTLYTDLGKpshESYVTEVSLVRSACKLAIKELKKWMA 98  Physcomitrella ...
NP_001053442  26 VSGTVAELRAAYESGRTRSLEWRQSQLRGLLRLLAEEEAAAFRALREDLGKhqaEAYRDEIGVLVKSANAALREVGKWMA 105 Japanese rice
CAO21920       7 LEPDLEELRESYRSGKTKEASWRKSQLKGLLTLLKEQEKDIFKALEQDLGKhyaESYRDEVGTLTKSVNLALSSLKDWMS 86  wine grape
XP_001757163   6 APQIVSELRATLRTARTRPAQWRLDQIRAVLKLVNENEDDIYAALHSDLHKsnyESFLTEVNVLVSACKSTMKNLHKWMA 85  Physcomitrella ...
Q8W033        75 AALLVDELRSNFNSGRTKSYEWRISQLQNIARMIDEKEKCITEALYQDLSKpelEAFLAEISNTKSSCMLAIKELKNWMA 154 thale cress
Feature 1                                     ###                         #                      
Q70E96        88 PKHSKlpllfYPAKGKVISEPYGTVLVLSSWNFPISLSLDPLIGAIAAGNTVLLKSSELSPNASAFLAKTIPaYLDTKAI 167 thale cress
Q70DU8        92 PEKAKtslttFPASAEIVSEPLGVVLVISAWNYPFLLSIDPVIGAISAGNAVVLKPSELAPASSALLTKLLEqYLDPSAV 171 thale cress
ABK24239      84 PEKVSttltvFPSKAEILPEPLGAALIISAWNYPLLLSMDPVIGAIAAGNVIVLKPSEVAPATSSLLATLIPqYLDDDAI 163 Sitka spruce
XP_001764841  99 PLKVSgsittFPSWGAIVAEPLGVALVISAWNFPFLLSVEPLVGAISAGCAMVLKPSEVAPATAALLSKLVPlYLDSSVI 178 Physcomitrella ...
NP_001053442 106 PEKVWvpliaFPARAQLEPQPLGVILVFSCWNVPLGLSLEPLVGALAAGNAVALKPSELAPATAKFLGDNVGkYMDATAV 185 Japanese rice
CAO21920      87 SRKAKlpiatFPSTAEVFPEPLGLVLIISSWNFPFGLSLEPVIGAIAAGNSVVLKPSELAPASSSLLAKTIPtYLDKKAV 166 wine grape
XP_001757163  86 PEKKPiplavWPANASVISEPLGVALVISPWNFPLLLALDPVVGAIAAGCTVCLKTSEIAPATSALLARLLPeYVDTEAI 165 Physcomitrella ...
Q8W033       155 PETVKtsvttFPSSAQIVSEPLGVVLVISAWNFPFLLSVEPVIGAIAAGNAVVLKPSEIAPAASSLLAKLFSeYLDNTTI 234 thale cress
Feature 1              #                 #                                                       
Q70E96       168 KVIEGGPDvATILLQHqWDKIFFTGSPKIGRIIMAAAAqHLTPVTLELGGKCPTIVDHHti-skNIKSVVKRIAGGKWGS 246 thale cress
Q70DU8       172 RVVEGAVTeTSALLEQkWDKIFYTGSSKIGRVIMAAAAkHLTPVVLELGGKSPVVVDSDt----DLKVTVRRIIVGKWGC 247 thale cress
ABK24239     164 RVVEGSVAeTTSLLEQkWDKIFYTGSGKIGRIVMAAAAkHLTPVTLELGGKCPVIVDPTv----DLEVTARRIVAGKWGC 239 Sitka spruce
XP_001764841 179 RVVEGGVDeTTVLLDQqWDKIFYTGSPRVGRIVMAAASkHLTPVTLELGGKCPVYIDRTa----DLKVGLRRIALGKWGC 254 Physcomitrella ...
NP_001053442 186 KVIQGGPEvGEQLMEHrWDKVLFTGSPRIARVVMAAAAkHLTPVALELGGKCPCIFDTIggsarDLQTAVNRVVGGKWSS 265 Japanese rice
CAO21920     167 KVIEGGAAvGEHLLRCkWDKIFFTGNPRVGRVVMTAAAnHLTPVTLELGGKCPAIFDSFss-swDKEMVIKRVLGGKFGA 245 wine grape
XP_001757163 166 KVVEGSIPeVTALLEQkWDKIFYTGNAKVGRIIMGAAAkHLTPVTLELGGKCPLFIDDSv----DLKVASKRIMVGKYGS 241 Physcomitrella ...
Q8W033       235 RVIEGGVPeTTALLDQkWDKIFFTGGARVARIIMAAAArNLTPVVLELGGKCPALVDSDv----NLQVAARRIIAGKWAC 310 thale cress
Feature 1                                                         # ##  #                        
Q70E96       247 cnGQACISVDYVLIEksFAPTLIDMLKPTIKSFFGenp-kesGCLSRIANKHHVQRLSRLLSDprvqaSIVYGGSIdedk 325 thale cress
Q70DU8       248 nnGQACVSPDYILTTkeYAPKLIDAMKLELEKFYGknp-iesKDMSRIVNSNHFDRLSKLLDEkevsdKIVYGGEKdren 326 thale cress
ABK24239     240 nnGQACIAPDYIITPesFAPKLIDALKNTLEKFYGqdp-iqsADLSRIVNSSHFVRLTRLLDDpkvsdKVIYGGQRdekr 318 Sitka spruce
XP_001764841 255 nnGQACIAPDYLLIDeiIASEVVDTLIDVIETFYGkdp-ktsQDLSRIVNTKHYSRLAGFLDDpkissKIVHGGARddnk 333 Physcomitrella ...
NP_001053442 266 caGQACLAIDYVLVEerFVPVLIKALKSTLKKFFAd-----sDHMARIVNARHFQRLSDLLKDksvaaSVLHGGTLdakn 340 Japanese rice
CAO21920     246 caGQACIAIDYILVQegFAPTLLELLRNMTKKMFGenp-retKSMARIINKKHFLRLKNILDDpsvqsCIVHGGGVdedn 324 wine grape
XP_001757163 242 naGQACISPDYVLVEehFAPTLIKQLQKTLLEFYGpdpsasvDLARIINKNHFQRLSSMLDDPsi-adKIVHGGERdeks 320 Physcomitrella ...
Q8W033       311 nsGQACIGVDYVITTkdFASKLIDALKTELETFFGqna-lesKDLSRIVNSFHFKRLESMLKEngvanKIVHGGRItedk 389 thale cress
Feature 1                            # #                                                         
Q70E96       326 LYVEPTILLDPPldSEIMNEEIFGPILPIITVRdIQESIGIINTKPKPLAIYAFTNDENLKTRILSeTSSGSVTFNDVMI 405 thale cress
Q70DU8       327 LKIAPTILLDVPldSLIMSEEIFGPLLPILTLNnLEESFDVIRSRPKPLAAYLFTHNKKLKERFAAtVSAGGIVVNDIAV 406 thale cress
ABK24239     319 LIIAPTLVLDAPmdSLIMIEEIFGPLLTIITVQkMEEALEVVSSFSKPLAAYVFTKNKKFERQVVAsVSAGGMLVNDTAL 398 Sitka spruce
XP_001764841 334 LYISPTLVCDVPmdSTLMSEEIFGPILPIIKVKgVQEAIDIISDRPKPLVAYVFTKNKEVEKRIVAsISSGGMVVNDTIV 413 Physcomitrella ...
NP_001053442 341 LCIEPTILLNPPldSAIMTEEIFGPLLPIITVKkIEDSIAFVRARPRPLAVYAFTKNAALRRRIVEeTSSGSVTFNDAVV 420 Japanese rice
CAO21920     325 LFIEPTILMNPPlkASIMTDEIFGPLLPIITLKkIEDSIEFINSRPKALAIYVFTKNETLKRRIISeTSSGSVTFNDAII 404 wine grape
XP_001757163 321 LYIAPTLIDNPPldSPVMVEEIFGPMLPIITVRnVDHALNIINDKPKPLEVYVFSNNKDLFNRFRDeTSSGGIVMNDCVL 400 Physcomitrella ...
Q8W033       390 LKISPTILLDVPeaSSMMQEEIFGPLLPIITVQkIEDGFQVIRSKPKPLAAYLFTNNKELEKQFVQdVSAGGITINDTVL 469 thale cress
Feature 1                                             
Q70E96       406 QYMCDALPFGGVGESGIGRYHGKYSFDCFSHEKAIME 442 thale cress
Q70DU8       407 HLALHTLPFGGVGESGMGAYHGKFSFDAFSHKKAVLY 443 thale cress
ABK24239     399 HVTNHHLPFGGVGESGVGSYHGKFSFEAFSHKKAVLY 435 Sitka spruce
XP_001764841 414 HFLNPGLPFGGVGESGMSSYHGKFSFDAFSHKKAVLY 450 Physcomitrella patens subsp. patens
NP_001053442 421 QYGIDSLPFGGVGESGFGQYHGKYSFEMFSHKKAVLT 457 Japanese rice
CAO21920     405 QYAADTIPFGGVGESGFGRYHGKFSFDTFTHEKAILR 441 wine grape
XP_001757163 401 QFIIPELPFGGVGESGTGAYHGKATFDAFSHRKAVLV 437 Physcomitrella patens subsp. patens
Q8W033       470 HVTVKDLPFGGVGESGIGAYHGKFSYETFSHKKGVLY 506 thale cress

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap