Conserved Protein Domain Family

cd07134: ALDH_AlkH-like 
Pseudomonas putida Aldehyde dehydrogenase AlkH-like
Aldehyde dehydrogenase AlkH (locus name P12693, EC= of the alkBFGHJKL operon that allows Pseudomonas putida to metabolize alkanes and the aldehyde dehydrogenase AldX of Bacillus subtilis (locus P46329, EC=, and similar sequences, are present in this CD.
PSSM-Id: 143452
Aligned: 23 rows
Threshold Bit Score: 676.637
Threshold Setting Gi: 21244955
Created: 1-Jan-2009
Updated: 2-Oct-2020
Aligned Rows:
NAD(P) bindingcatalytic
Feature 1:NAD(P) binding site [chemical binding site]
  • Comment:based on similarity to structure 1AD3, class 3 rat liver aldehyde dehydrogenase (ALDH3A1)
  • Citation:PMID 9095201

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                        
Feature 1                                     ###                         #                      
Feature 1              #                 #                                                       
Feature 1                                                      # ##  #                           
Feature 1                          # #                                                           
Feature 1                                           
P12693       420 LHPNLPFGGVNNSGIGSAHGVYGFRAFSHEKPVLI 454 Pseudomonas mendocina ymp
P46329       407 SDVNLPFGGVNTSGIGSYHGVYGFKEFSHEKGVFI 441 Bacillus subtilis subsp. subtilis str. 168
NP_969103    402 ANPHLPFGGVNHSGMGSYHGKHGFLEFSHQKAVLK 436 Bdellovibrio bacteriovorus HD100
ZP_01463895  416 ANPHLPFGGVGQSGLGAYHGEEGFRELSHARAVLW 450 Stigmatella aurantiaca DW4/3-1
YP_628894    419 ANPNLPFGGVGTSGLGNYHGHFGFKTFSHERAVMV 453 Myxococcus xanthus DK 1622
YP_445580    417 ANPDLPFGGAGHSGIGRGHGEAGFRAFSNERSVLR 451 Salinibacter ruber DSM 13855
YP_001545290 471 VNPNLPFGGVGQSGIGNYHGFYSFKTFSHERAVFQ 505 Herpetosiphon aurantiacus ATCC 23779
YP_496476    411 LENNLPFGGVNTSGMGSYHGVFGFKCFSHERAVYR 445 Novosphingobium aromaticivorans DSM 12444
NP_711050    432 ANPNLPFGGINHSGHGSYHGYFGFKAFSHERSVLR 466 Leptospira interrogans serovar Lai str. 56601
ZP_02182127  414 FNNNLPFGGSNNSGIGKAKGIFGFQAFSNARGVYQ 448 Flavobacteriales bacterium ALC-1

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap