Conserved Protein Domain Family
ALDH_AlkH-like

?
cd07134: ALDH_AlkH-like 
Pseudomonas putida Aldehyde dehydrogenase AlkH-like
Aldehyde dehydrogenase AlkH (locus name P12693, EC=1.2.1.3) of the alkBFGHJKL operon that allows Pseudomonas putida to metabolize alkanes and the aldehyde dehydrogenase AldX of Bacillus subtilis (locus P46329, EC=1.2.1.3), and similar sequences, are present in this CD.
Statistics
?
PSSM-Id: 143452
View PSSM: cd07134
Aligned: 23 rows
Threshold Bit Score: 676.637
Threshold Setting Gi: 21244955
Created: 1-Jan-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
NAD(P) bindingcatalytic
Feature 1:NAD(P) binding site [chemical binding site]
Evidence:
  • Comment:based on similarity to structure 1AD3, class 3 rat liver aldehyde dehydrogenase (ALDH3A1)
  • Citation:PMID 9095201

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                        
P12693        20 LEVFNLQKVASSARrgkfGIAERIAALNLLKETIQRREPEIIAALAADFRKPasEVKLTEIFPVLQEINHAKRNLKDWMK 99  Pseudomonas men...
P46329        10 QRVFQLQKKQQKALra-sTAEQRREKLQRFLDSVIAHEEEIIEAIRKDVRKPyhEVKKAEIEGTKKAIRDNMNNLEQWMA 88  Bacillus subtil...
NP_969103      2 LERIFLHQKQFALKlrgeSLDVRIEALEALEKSIELHKQDIIDALKKDFQKPeaETLLSEIYPVLKEITYAKKNLSRWAK 81  Bdellovibrio ba...
ZP_01463895   17 REAFERLQSRRWEMaq-tGAPERLARLARLKTNLLARREALAEAMFADFRKPraEVESTEVLPVLLELAHTARHLKAWMK 95  Stigmatella aur...
YP_628894     20 RAVFEAQRAHRWTMsr-tTAAERIARLKRLREAIIARRAELADAIHADFRKPamEVDLTELHPTLEELNHTVRHLKSWMK 98  Myxococcus xant...
YP_445580     18 ERVFAAQQAHAPAVra-aSVDRRRDKLRRLCDGLRAHRTDFQDAIHADFRKApaEVDLTEMKPLLDEAQFAISHLDDWMA 96  Salinibacter ru...
YP_001545290  72 HGQFAALQAQRGRIaa-sRAPERIGYLQQFKRAIEQARPDIHAALQADFAKPaaEIEATEIQQVIEQINFAIKRLETWMQ 150 Herpetosiphon a...
YP_496476     14 ARVFALQQAHMWEAka-sTAAERKEKLARLKAAVEAHADDIVAAVLEDTRKPvgEIRVTEVLNVTANIQRNIDNLDEWMK 92  Novosphingobium...
NP_711050     35 ERVFNLQKKHFHKVmkltTAGQRIQRLKKLKEAIFKYSPEIEKAVHSDFRKSerEVDITEIMPSISEINDAIKHVRRWMK 114 Leptospira inte...
ZP_02182127   18 QRIFNLHMQNKQEVrn-tTYADRRAKIKKLLKVYLKYRPQIREACYKDFKKHpiEVDLTEIYSVVHEAKHTLNHLHKWMK 96  Flavobacteriale...
Feature 1                                     ###                         #                      
P12693       100 PRRVRaalsvaGTRAGLRYEPKGVCLIIAPWNYPFNLSFGPLVSALAAGNSVVIKPSElTPHTATLIGSIVReaFSVDLV 179 Pseudomonas men...
P46329        89 PKEVGssl-spDANGILMYEPKGVTLILGPWNYPFMLTMAPLAASLAAGNSAIVKLSDfTMNTSNIAAKVIRdaFNEKEV 167 Bacillus subtil...
NP_969103     82 GRRVPtpltlfGSKSYIVPEARGVCLLIAPWNYPFQLAFSPLVSAIASGNCAIMKPSEqTRHTSSIIKKITTeaFHPDHV 161 Bdellovibrio ba...
ZP_01463895   96 PRRVGapvllaGTRSEVHSEPKGVVLVLSPWNYPFCLAINPLIAALAAGNCVMLKPSEkTPRTAAFLEALVRdtFEPSEV 175 Stigmatella aur...
YP_628894     99 PMRVGtpmllaGSSSHVRYEARGTVLLLSPWNYPFNLLVSPLVAAIAAGNTVICKPSEkTPHTSRFLAQLVKdvFPENEV 178 Myxococcus xant...
YP_445580     97 PDRRShpaffaGTRSEIHYEPKGVALILAPWNYPLTLTLGPLIGALAAGNCVTLKPSEkTPHTNIVLKKLIGdlYEEREV 176 Salinibacter ru...
YP_001545290 151 PKRVKtptmltGSKSWIQYEPRGVVLILAPWNYPLSLALMPLIGAVAAGNCAIVRPSErMPHTAQVVANIIAtaFKPEHV 230 Herpetosiphon a...
YP_496476     93 PVEVAtsl-npADRAQIIHEARGVCLILGPWNFPLGLALGPVAAAIAAGNTCIVKLTDlCPATARVASVIVReaFDEKDV 171 Novosphingobium...
NP_711050    115 PVDVKtpmtlfGSKSQIIYEPRGVVLIIGPWNYPFYLTFAPLAAAIAAGNTVLIKPSEfTPVTSNLIQKIISevFPKEEV 194 Leptospira inte...
ZP_02182127   97 PQKVStplalfGSSSKILYQSKGTVLIISPWNFPFTLTFEPLISAIAAGNTVIIKPSEiTSNSASLMKKIIEevFDEKEV 176 Flavobacteriale...
Feature 1              #                 #                                                       
P12693       180 AVVEGDAAvSQELLALPFDHIFFTGSPRVGKLVMEAASKtLASVTLELGGKSPTIIGPTaNLPKAARNIVWGKFSNnGQT 259 Pseudomonas men...
P46329       168 AIFEGEVEvATELLDQPFDHIFFTGSTNVGKIVMTAAAKhLASVTLELGGKSPTIIDSEyDLMDAAKKIAVGKFVNaGQT 247 Bacillus subtil...
NP_969103    162 FVAEGGPEtTQELLSFAFDHIFFTGSTRVGKIVMTAAAKnLASVTLELGGKSPTIVDATaNLAEAAEKIAWAKFINaGQT 241 Bdellovibrio ba...
ZP_01463895  176 TVVQGGPDvGDALLQLPFDHFFFTGGSRVGQKVMAAAARhLAGVTLELGGKSPVIVDATaDVKAAAERIIWGKFVNaGQT 255 Stigmatella aur...
YP_628894    179 ALFEGGAEtAEALLELPFDHIFFTGNTRIGRKVMEAAAKhLASVTLELGGKSPVIVDETaDVAAAAERLCWGKFVNgGQT 258 Myxococcus xant...
YP_445580    177 ALLTGAKEvAQGLLEQPYDHVYFTGSPRVGRLVMKDAADhLASVTLELGGKSPAIVDETaDLDLAAERIAWSKFTNaGQT 256 Salinibacter ru...
YP_001545290 231 TSVVGDVDtAEALLDLPFDHIFFTGSPRIGQYVMQRAAEhFSSVTLELGGKSPAIVDRSaDLKRAAQAIVWGKFVNaGQT 310 Herpetosiphon a...
YP_496476    172 ALFEGDVSvATALLDLPFNHVFFTGSPRVGKIVMAAAAKhLTSVTLELGGKSPVIVDDSaDIDQVAAQLAAAKQFNgGQA 251 Novosphingobium...
NP_711050    195 AVFEGDYQvSGALMELPLDHIFFTGSTHVGKIVMTAAAKhLTTVTLELGGKSPAIIDKSaDIKKAAKKLIWGKVLNaGQT 274 Leptospira inte...
ZP_02182127  177 AYFEGGVEtSTNLLKLPFNHIFFTGSPGVGKIVMAAAAKnLTSVTLELGGKSPTIIDETaNIDMAAKRTSWSKFLNnGQI 256 Flavobacteriale...
Feature 1                                                      # ##  #                           
P12693       260 CIAPDHVFVHrciAQKFNEILVKEIVRVygkdfaaqrrsADYCRIVNDQHFNRINKLLTDAKaKGAKILQGGQVdateRL 339 Pseudomonas men...
P46329       248 CIAPDYLFIKkdvQDRFAGILQTVVNAGfmedd-htpdrSKFTQIVNDRNFNRVKDLFDDAIeRGAEVVFGGVFdasdRT 326 Bacillus subtil...
NP_969103    242 CVAPDYLFVHesvQHNFKKHLIAALEKFygksaeqrkqsPDFARMISFNHSQRLKDLIDEAVsKNAKVFFGGESqpeeHY 321 Bdellovibrio ba...
ZP_01463895  256 CIAPDHVYVHasrEEELLAGMKEALERFygkteearrasPDLCRMVDDAAFARVRGLLDRTVqAGARLVAGGGVdaasRY 335 Stigmatella aur...
YP_628894    259 CVAPDYVFVHaskERAFLDALKASITRFyggteqerqasPDLTRLVDPVAWRRVKDLLKRSVaAGAKVEVGGETdepsRY 338 Myxococcus xant...
YP_445580    257 CIAPDYVLVDapvHDALVARLIDTIEHFygataamrrgsDDYARLIDDGHWDRVVGLLEEAVaDGATVAFGGQTnaetRY 336 Salinibacter ru...
YP_001545290 311 CVAPDHVWVQreqAQALTQLIIKQIERNygkgdytrlqsPDLANVIDANATARLRGLVNNSVaQGALVALGGQStdhpAR 390 Herpetosiphon a...
YP_496476    252 CISPDYVFVKedkKAALVEGFRANVQKNlydda-gnlkkDSIAQVVNKANFDRVKAMFDDAVaKGATVAAGGTFeaddLT 330 Novosphingobium...
NP_711050    275 CVAPDYLLIPnelIKPFVEEAKTVIKEFygns---lkenSDFCRIVNDRNFNRVSGYIHEAVeKGAKIEMGGDTdasqNY 351 Leptospira inte...
ZP_02182127  257 CIAPDHIFVHeskKDEYIASVKKYIKKFfsdd---askeSSYGRIVNQMHHQRISKYLEDAIeKGGKIEAGGKLdktqNY 333 Flavobacteriale...
Feature 1                          # #                                                           
P12693       340 VVPTVLSNVtaaMDINHEEIFGPLLPIIEYDdIDSVIKRVNDGDKPLALYVFSEdkQFVNNIVArTSSGSVGVNLSVVHF 419 Pseudomonas men...
P46329       327 ISPTVLKNVtpdMKIMQEEIFASILPMMNYEdIDEVIDYVNDRDKPLALYVFSKnqDLIDNVLQhTTSGNAAINDVVVHF 406 Bacillus subtil...
NP_969103    322 CGPTLIEGVdphSLIMQEEIFGPILPVMTFKeISEVIHFINERPKPLALYCYTHsqMNMEKIEKeTSSGGLVYNDSVIHF 401 Bdellovibrio ba...
ZP_01463895  336 IAPTLLADVtarSPVMEEEIFGPLLPVLRYErVETLVESLRADGKPLALYLFSQddAAVEYLLKrTSAGGTVVNNVLLQV 415 Stigmatella aur...
YP_628894    339 IAPTVLSGVtaeNPVMEGEIFGPVLPVLTFQsREEVYAHIRAGGKPLALYVFSQdkRAVEDIFQnTTSGGAVVNNVLVHL 418 Myxococcus xant...
YP_445580    337 VSPTILTDVpldTAVMQAEIFGPLLPIIPISsLNQAVGIVNDRPNPLSMYLFSErdAMVDTVLGrTTAGSTCINEGFFHY 416 Salinibacter ru...
YP_001545290 391 FAPTVLTNVkpsMAIMQEEIFGPILPILVYDqIDEVIMATRASGKPLTMAIFAEnqAIINWLLReIPAGSSMINGVLLNV 470 Herpetosiphon a...
YP_496476    331 IHPTMLTGVtpqMTILQDEIFAPVIPVMTYDtLDQAIGYIEARDKPLALYVYSKdeANVEKVLArTSSGGVTVNGVFSHY 410 Novosphingobium...
NP_711050    352 IEPTLLSNVpenSNIMEDEIFGPVLPMIPYTnLDEAIEKINSKPKPLALYIFGKkdRSIKKILKeTSSGGVAVNDVILHL 431 Leptospira inte...
ZP_02182127  334 ISPTIITNLsedSDLLQEEIFGPVMPIIAYKdIDEVIEKINSKETPLALYIYSKskKNINYVLNnTSAGGSCVNHNAIHY 413 Flavobacteriale...
Feature 1                                           
P12693       420 LHPNLPFGGVNNSGIGSAHGVYGFRAFSHEKPVLI 454 Pseudomonas mendocina ymp
P46329       407 SDVNLPFGGVNTSGIGSYHGVYGFKEFSHEKGVFI 441 Bacillus subtilis subsp. subtilis str. 168
NP_969103    402 ANPHLPFGGVNHSGMGSYHGKHGFLEFSHQKAVLK 436 Bdellovibrio bacteriovorus HD100
ZP_01463895  416 ANPHLPFGGVGQSGLGAYHGEEGFRELSHARAVLW 450 Stigmatella aurantiaca DW4/3-1
YP_628894    419 ANPNLPFGGVGTSGLGNYHGHFGFKTFSHERAVMV 453 Myxococcus xanthus DK 1622
YP_445580    417 ANPDLPFGGAGHSGIGRGHGEAGFRAFSNERSVLR 451 Salinibacter ruber DSM 13855
YP_001545290 471 VNPNLPFGGVGQSGIGNYHGFYSFKTFSHERAVFQ 505 Herpetosiphon aurantiacus ATCC 23779
YP_496476    411 LENNLPFGGVNTSGMGSYHGVFGFKCFSHERAVYR 445 Novosphingobium aromaticivorans DSM 12444
NP_711050    432 ANPNLPFGGINHSGHGSYHGYFGFKAFSHERSVLR 466 Leptospira interrogans serovar Lai str. 56601
ZP_02182127  414 FNNNLPFGGSNNSGIGKAKGIFGFQAFSNARGVYQ 448 Flavobacteriales bacterium ALC-1

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap