Conserved Protein Domain Family
ALDH_CALDH_CalB

?
cd07133: ALDH_CALDH_CalB 
Coniferyl aldehyde dehydrogenase-like
Coniferyl aldehyde dehydrogenase (CALDH, EC=1.2.1.68) of Pseudomonas sp. strain HR199 (CalB) which catalyzes the NAD+-dependent oxidation of coniferyl aldehyde to ferulic acid, and similar sequences, are present in this CD.
Statistics
?
PSSM-Id: 143451
View PSSM: cd07133
Aligned: 72 rows
Threshold Bit Score: 626.82
Threshold Setting Gi: 88704711
Created: 1-Jan-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
NAD(P) bindingcatalytic
Feature 1:NAD(P) binding site [chemical binding site]
Evidence:
  • Comment:based on similarity to structure 1AD3, class 3 rat liver aldehyde dehydrogenase (ALDH3A1)
  • Citation:PMID 9095201

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                        
O86447        17 GSALDRMKKAHLEQgpaNLELRLSRLDRAIAMLLENREAIADAVSADFGNRsr-eQTLLCDIAGSVASLKDSREHVAKWm 95  Pseudomonas sp....
YP_340637     10 AALLQHQQQAHKLQmlvTAAQRRERIQQVINLLVEHHQAFAEAIEADFNGRsq-gFSIMNDVLGSLASLKYTRDNLEPWl 88  Pseudoalteromon...
NP_783904      9 HQIFNLQKIQYDRAqpmTYEERVTVLNQIEALIRDNIPELITALQADFGQRdp-lQILSADLTGPLATIAYIKKHLRKWi 87  Lactobacillus p...
ZP_01914134    2 QDVFDCQQRTYRANphpSKQERISNLELLEEIILRNEGELLDAMSEDFGHRsr-hESTMLDIVSSLSAVRHSRKHVGMWm 80  Limnobacter sp....
ZP_01625132   18 DALIKLQRSKFRAEgevTYATRIDRLKRLKALILENKVEFANTTKREFNGArsyeFSLFSEFGSKVEAIDYSIKHLKEWm 97  marine gamma pr...
ABO11525      18 ELIFSKQRANFEADpypSLEARRTKLHQLKKQIIRYQDALAAAINADFSSRsl-dESKLLDLLGSVLEADHAIHHLRRWm 96  Acinetobacter b...
YP_298830     12 QRWLGKQRAAFMASpfpSLGERRDTLRCLRTAIRGHAHRLAAAAQRDFSARae-aETLMVDVLPSVMHINHLLRGLRRWm 90  Ralstonia eutro...
YP_001135593  15 SSMLERQRAAFVADgppDVALRRNRIDRLMALVLDNVDDFVDAMGRDFGTRpk-qGSLFTEIMGMISVIEHTRSHVPQWm 93  Mycobacterium g...
YP_001501975   9 TQLLTQQKQAHLASpnpSASERKKRIQQVIDVLVANHSALVTAMEADFGGRsq-gFSLMNDVLGSLGSLKHTRDNLDDWm 87  Shewanella peal...
ZP_01102424   25 NAILEQQKAAFQKNpmpTLKERTEWLDAIIAMMLEYRPKILDALNTDFGTHpt-lQGDFIEVFGMLARAEYNKTKLDEWm 103 Congregibacter ...
Feature 1                                        ###                         #                   
O86447        96 EPEHHKamf----pgAEARVEFQPLGVVGVISPWNFPIVLAFGPLAGIFAAGNRAMLKPSElTPRTSALLAELIAryFDE 171 Pseudomonas sp....
YP_340637     89 KSESREvfapydqlgSTARVEYQPKGSVGIIGTWNAPLYTLFAPLACVLGAGNRAILKPSEvTPKTAALVAQLFAkhIDP 168 Pseudoalteromon...
NP_783904     88 LPAKQRsglm-altgTKQYVYNEPLGVVGIMSPFNAPIDLALDPAVEAIAAGNRVMVKISEyTPKTAALVQKLSQqyLNE 166 Lactobacillus p...
ZP_01914134   81 KVRKVPtplq--lrpSVSYIKPQPLGIIGIITPWNFPVYLSFAGLASALAAGNCCMLKPSEySPRTSALMARLLEnnFGE 158 Limnobacter sp....
ZP_01625132   98 KPEKRKtnkpmnflgGKGQVRHFPKGVVGIISPWNLPFGLTVAPLTSALAAGNRALLKPSEfVPETAALFAEVVPkyFSK 177 marine gamma pr...
ABO11525      97 RPSKRRtell--flsNRLSVQYQPKGVVGVIVPWNFPVYLALGPLIAALAAGNRVMIKLPEiTPNTNAMLRRMLAevFNE 174 Acinetobacter b...
YP_298830     91 KPSRRHtell--ffgNSARVMYQPKGVVGIVVPWNFPVYLALGPLATALAAGNRCMVKTSEyAPHTSAALRALLRevFDE 168 Ralstonia eutro...
YP_001135593  94 KPNRMMrpar--mfgLRAEVEPTPLGVVGVIGPWNFPLNLVVLPAVAAFAAGNRVMIKMSEvTPRTAELMRRLSAeyFEP 171 Mycobacterium g...
YP_001501975  88 AAETRQpftpydqlgAKAEVSFQAKGCVGIIGTWNAPLYTLLSPLACALGAGNRAILKPSElTPRTAQTIAELFEkfISP 167 Shewanella peal...
ZP_01102424  104 QPSLREtdps-mhgeSSAYVLRQPKGVIGNMSPWNFPFDLTIGPLCDMLAAGNRVMIKPSEiSSACSELLLEMINatFNE 182 Congregibacter ...
Feature 1                 #                 #                                                    
O86447       172 TELTTVLGDAEvGALFSAQPFDHLIFTGGTAVAKHIMRAAAdNLVPVTLELGGKSPVIVSRSa-DMADVAQRVLTVKTFN 250 Pseudomonas sp....
YP_340637    169 LLVSVVTGGADtGAKFSELPFDHLVFTGSTQVGKKIMAAAAkNLVPVTLELGGKSPAVLSQDc-DLSESCKRLALAKSNN 247 Pseudoalteromon...
NP_783904    167 KNFAVVTGEADiAAQFSALDWDKLVFTGGSETGKKVLSAAApNLTPVVLELGGKNPAVVLPDa-NKQMTAAKIARSRSGN 245 Lactobacillus p...
ZP_01914134  159 EHVAVIEGDETvADAFSRLPFDHLLFTGSQRVGRLVAKAAAeNLTPVTLEMGGKSPLIVAPSg-NVAQAAACAAHGKMIN 237 Limnobacter sp....
ZP_01625132  178 DEVAVVTGGAEiSQKFAELPFDHLLFTGSTRVGAQIMQAASkNLVPVTLELGGKSPVIIGRSa-NLELAGTRLTFSKFLN 256 marine gamma pr...
ABO11525     175 DEVAVFGEEITdPARFTTLPFNHIVFTGSPAIGKVVMRAAAeNLTPVTLELGGKSPAIVSRNy-PLADAAKRITHGKATN 253 Acinetobacter b...
YP_298830    169 DRVAIVEGDAEiARAFTSLPFDHIVFTGSPEIGRHVMRAAAaNLTPVTLELGGKSPAIVSRSa-NLRTAATRIAHGKTVN 247 Ralstonia eutro...
YP_001135593 172 TELCVVTGGADvAAEFAALPFDHLFFTGSPSVGVLVQRAAAaNLVPVTLELGGKNPVVVGPGa-DMRRAATRIAQGRMIN 250 Mycobacterium g...
YP_001501975 168 EVVTVVTGAAQiGAAFAALPFDHLVFTGSSAIGRKVMAAAAeNLTPVTLELGGKSPAIISASa-NLDQACYRLAIAKGTN 246 Shewanella peal...
ZP_01102424  183 DHVAVVLGDLDvAKAFPALPFDHLLYTGNPGVARQVAAAAApNLTPLTLELGGKSPTVFTPGgvTAANVADCLRIKMIKN 262 Congregibacter ...
Feature 1                                                       # ##  #                          
O86447       251 aGQICLAPDYVLLPeesLDSFVAEATRFVAAMypsl-ldnPDYTSIINARNFDRLHRYLTDAQAKGGRVIEINPAaeelg 329 Pseudomonas sp....
YP_340637    248 gGQVCVSPDIVYVPrnkLDQVAALLLENFSHFypei-thnPDFVPSVNRQHCQRVVDLVEQARDAGCQVLSSHEVanlae 326 Pseudoalteromon...
NP_783904    246 sGQICLDTDYVLLPtdqLDEYVGLITAQLAQVfpty-innSEYSAIINDRSYDRILGMLTEARQRGTRLITINPNnelvp 324 Lactobacillus p...
ZP_01914134  238 aGQVCVAPDYAMVHesqLRRFISEVKRASHKQypti-rnnPDVSCVINSKHMARLRDLVEDARKKGAEIIEINPAhevf- 315 Limnobacter sp....
ZP_01625132  257 gGQLCLSPDYVLVPrelEEQLVARVIHEAQSMypnv-tenEDYAGVINERHFARLQNYIDDAVAKGAKLTIVGADqtra- 334 marine gamma pr...
ABO11525     254 sGQICVAPDYALVPkesIDEFVDAAKSSFIKMfgqsiennENYTSIVNDRHLKRIQDILTDAQEKGARIIPCDTYsfd-- 331 Acinetobacter b...
YP_298830    248 gGQICVAPDYALVPaedAEPFAQAVLDAASQMhpq---gsDDYTAVIHDGALARQRALLDDARALGARVFSAAMPsg--- 321 Ralstonia eutro...
YP_001135593 251 gGQVCVCPDYVFVPaarIDAFVAVARETLQAMfpti-vanDDFCSSVNEANFERVVGLIEDARAKGARVESVAPAgeslp 329 Mycobacterium g...
YP_001501975 247 gGQICVSPDIIYLHqenLEQGISTLKQVFSSLypsi-sgnQDLVPIVNQAHFERVESYINDAKDKGVRVESSHQTsad-- 323 Shewanella peal...
ZP_01102424  263 -GQMCVSPDYALVPradLENFVSLAKAFISKEapdy-vagDDITGIINDRHYARIESILDDARTRESQIEQLTGEsda-- 338 Congregibacter ...
Feature 1                                 # #                                                    
O86447       330 -dsgiRKIAPTLIVNVsdeMLVLNEEIFGPLLPIKTYRdFDSAIDYVNSKQRPLASYFFGEDaVEREQVLKrTVSGAVVV 408 Pseudomonas sp....
YP_340637    327 lvtsdKRLPLQLVISPdkeLDIMQQEIFGAALVLLPYDdIDGVINDINSRAKPLALYYFGENdAELSKLLAnTSSGGVAI 406 Pseudoalteromon...
NP_783904    325 -yvkrRLIPLTLAINPdrdLQIARNEIFGPILSIFTYDsLDEAIAFINSHEKPLAMYLFGRSsRHLNQIISqTSSGGVDI 403 Lactobacillus p...
ZP_01914134  316 -epsaKKFPLTLVVNPsadMRVMQEEVFGSILPILAYRtLEEAVAQVQSKERAIALYLFVSKqAEKELVLSqTVSGGVTV 394 Limnobacter sp....
ZP_01625132  335 -sednRRMPLHILQNVnedMLVMHEEIFGPILPIMSYGdITEVPDQVEPRRNPLAMYYFGKDkSEQEYLLShVPSGGVCI 413 marine gamma pr...
ABO11525     332 --qqgRRMPVQIVLNCtpdMRIMKEELFGPILPVVAYDsLDDAITYVKSDERPLALYCFTHSsVERDRILReTHSGGVTI 409 Acinetobacter b...
YP_298830    322 ----gRRLPLHVVLGVtpqMRLAQEEIFGPILPVFTYRsFDEAIAHVQSGTRPLALYYFGHDkAETGPLLErTHAGGVTL 397 Ralstonia eutro...
YP_001135593 330 -dpgtRKIAPTILRDVddsMLIASEETFGPVLTVRPYEkLADVVEYVNARPAPLVTYWFGPDdHDFRSFVRqTRSGGVAR 408 Mycobacterium g...
YP_001501975 324 --amtRRAPLRIVVNPhnsCDIMQHEIFGLAVVIKTYSeIDEVISDINSRDNPLALYYFGENsTEQAKVLGlTRSGGVTI 401 Shewanella peal...
ZP_01102424  339 ---aaRRMALSLVVNPsedSLVMTEEIFGPIMAVVPYDsLDEGIAYINARERPLGLYVYGSDkALCDEVINrTSSGGVTV 415 Congregibacter ...
Feature 1                                                   
O86447       409 NDVMSHVMMDTLPFGGVGHSGMGAYHG-IYGFRTFSHAKPVLV 450 Pseudomonas sp. HR199
YP_340637    407 NDCLMHAALHDAPFGGIGASGMGHYHG-REGFLAFSHQRTVFV 448 Pseudoalteromonas haloplanktis TAC125
NP_783904    404 NELSLHAGSHSMGFGGVGYSGMGRYKGgKIGFETFSNQKSVYK 446 Lactobacillus plantarum WCFS1
ZP_01914134  395 NDAMWHVLNDHMPFGGVGASGMGAYHG-LVGFNAMSQLKPVLE 436 Limnobacter sp. MED105
ZP_01625132  414 NDITLHYVQEDLPFGGVGASGMGAYHG-PEGFKTLSHPRAIYS 455 marine gamma proteobacterium HTCC2080
ABO11525     410 NDWGWHVVNHDAPFGGIGNSGMGSYHG-EEGFRELSHAKTVFI 451 Acinetobacter baumannii ATCC 17978
YP_298830    398 NDWGWHVVNHDLPFGGSGTSGMGNYHG-AEGFRELSHAKSVFA 439 Ralstonia eutropha JMP134
YP_001135593 409 NDFAAQMIPSAAPFGGVGRSGMGAYHG-KAGFDAFSHYRTVVG 450 Mycobacterium gilvum PYR-GCK
YP_001501975 402 NDALMHAAMHDAPFGGTGASGMGHYHG-KEGFLQFSHMKTVLT 443 Shewanella pealeana ATCC 700345
ZP_01102424  416 NGAALHASLPGMGFGGTGNSGYGRHHG-IEGFMEFTNPRGIMN 457 Congregibacter litoralis KT71

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap