2JG7,2J6L


Conserved Protein Domain Family
ALDH_F7_AASADH

?
cd07130: ALDH_F7_AASADH 
Click on image for an interactive view with Cn3D
NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase, ALDH family members 7A1 and 7B
Alpha-aminoadipic semialdehyde dehydrogenase (AASADH, EC=1.2.1.31), also known as ALDH7A1, Antiquitin-1, ALDH7B, or delta-1-piperideine-6-carboxylate dehydrogenase (P6CDH), is a NAD+-dependent ALDH. Human ALDH7A1 is involved in the pipecolic acid pathway of lysine catabolism, catalyzing the oxidation of alpha-aminoadipic semialdehyde to alpha-aminoadipate. Arabidopsis thaliana ALDH7B4 appears to be an osmotic-stress-inducible ALDH gene encoding a turgor-responsive or stress-inducible ALDH. The Streptomyces clavuligerus P6CDH appears to be involved in cephamycin biosynthesis, catalyzing the second stage of the two-step conversion of lysine to alpha-aminoadipic acid. The ALDH7A1 enzyme and others in this group have been observed as tetramers, yet the bacterial P6CDH enzyme has been reported as a monomer.
Statistics
?
PSSM-Id: 143448
View PSSM: cd07130
Aligned: 32 rows
Threshold Bit Score: 759.05
Threshold Setting Gi: 15842884
Created: 2-Jan-2009
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 21 residues -Click on image for an interactive view with Cn3D
Feature 1:NAD binding site [chemical binding site]
Evidence:
  • Structure:2JG7; Acanthopagrus schlegelii Seabream antiquitin (alpha-aminoadipic semialdehyde dehydrogenase) in complex with cofactor NAD+, defined using 3.5 A.
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                       
2JG7_A       24 GVYNGSWGGSg---EVITSYCPANNEPIARVTQatlaEYEETVQKTREAWKMWAdiPAPKRGEIVRQIGDALRKKIKVLG 100 black porgy
YP_826328    28 GACFGDWIAEps-gGELVSSSPATGEALARVRTagpgDYETVMEFATAAFLEWRmlPAPKRGEIVREIGNELRAHKQHLG 106 Solibacter usita...
YP_066068    44 ICTGTEWISPag-sKVIESISPVDGRIIAKIQAggapEYKRIITQAQKAFPLWRkiPAPERGEIVRQIGEALRKDKENLG 122 Desulfotalea psy...
NP_393917    21 GVYDGEWVKPs--gKMLTVKSPIDGSEVAKISLatraDYDRLVSRAIEEFKKWRmiPAPKRGLIIREIGDELRKEKKNLG 98  Thermoplasma aci...
ZP_01854163  21 VAVSNTWQAGs--gEPLTVVSPIDGSTLVSLRQatrsDVDLVIETSKNAFHQWRevPAPRRGEFVRLLGEALRKHKADLA 98  Planctomyces mar...
ZP_01886654  20 GYSSGSNAASlsngPAIDSYSPVDGSKIASVETateeNYNTVMAKAGEAFLFWRtqPAPKRGELVRQLGDALRTKKEALG 99  Pedobacter sp. B...
NP_518282    11 RLHLDTLTGGd---GPLAARSPIDGAVLARLPVetaaDADRIVAQAHAAFRNWRtvPAPRRGELVRLLGEELRAHKADLG 87  Ralstonia solana...
NP_104106    14 LGVAKDALVG----GDLIVRSPVTGEQIAALKTispaDAAKTIDAAHKAFQSWRlvPGPKRGELVRLLGEELRAHKAELG 89  Mesorhizobium lo...
NP_337921     9 GVTAALGEPGe---HSLPASTPITGDVLFSIAPttpeQADHAIAAAAATFTAWRstPAPVRGALVARLGELLTAHQQDLA 85  Mycobacterium tu...
ZP_01076288  25 LTGNHEVLGQg---DRFSASSPINGEPLSSFKNasldQLESINEEMRQAFKTFRtmPAPVRGELVRRIGDEARKYKTELA 101 Marinomonas sp. ...
Feature 1                                                                     ####              
2JG7_A      101 SLVSLEMGKIYVEGVGEVQEYVDVCDYAVGLSRMIGGPVLPSERPGHALIEQWNPVGLVGIITAFNFPVAVYGWNNAIAL 180 black porgy
YP_826328   107 ALVSLEMGKILPEGLGEVQEMIDICDFAVGLSRQLYGLTMHSERPGHRMYEQWHPLGVVGVISAFNFPVAVWAWNAMIAA 186 Solibacter usita...
YP_066068   123 RMICLEMGKSLQEGYGEVQEMIDVCDFAVGQSRMLYGATMPSERPSHRLYDQYHPLGVVGIITAFNFPAAVWAWNAMLST 202 Desulfotalea psy...
NP_393917    99 KIVTIEAGKTPSEGEGEIQEMIDISDLALGLSRQLYGLTIASERPYHRMYEQWVPLGPVAVITSFNFPASVWSWNAFIAA 178 Thermoplasma aci...
ZP_01854163  99 AIVSWEAGKITQEALGEVQEMIDICDFAVGLSRQLYGKTIASERPGHRLMEQWQPLGPVGVISAFNFPVAVWAWNAMLAF 178 Planctomyces mar...
ZP_01886654 100 TLVSYEMGKSLQEGLGEVQEMIDICDFAVGLSRQLYGLTMHSERSNHRMYEQWHPLGIVGIISAFNFPVAVWSWNAALAL 179 Pedobacter sp. B...
NP_518282    88 ALVTLEAGKITQEGLGEVQEMIDICDFAVGLSRQLYGLTIASERPAHRMMETWHPLGPCLVITAFNFPVAVWAWNATLAL 167 Ralstonia solana...
NP_104106    90 RLVSIEVGKIPSEGLGEVQEMIDICDFAVGLSRQLYGLTIATERPGHRMMETWHPLGVVGVISAFNFPVAVWSWNAALAL 169 Mesorhizobium lo...
NP_337921    86 TLVTVEVGKITAEARGEVQEMIDVCQFSVGLSRQLYGRTIASERAGHRLLETWHPLGVVGVITAFNFPVAVWAWNTAVAL 165 Mycobacterium tu...
ZP_01076288 102 QVISLEAGKIMPEALGEVQEWIDVCDFAVGQSRMLHGLSIVSERPGHRMMEQWHPLGPVAVITAFNFPMAVWAWNAMLGL 181 Marinomonas sp. ...
Feature 1               # ##                                       ##            ####  #  #     
2JG7_A      181 TCGNVCLWKGAPtTPLTSVAVTKIVAEvle--qnNLPGAICSMTCGGADi-GTAMAKDErVDLLSFTGSTHVGKMVAMMV 257 black porgy
YP_826328   187 VCGDCVLWRPSSeTPLLAIAVQKIVNRvf---drHGLKGIFNLVIGPSNpiGEILVKDPrIPLISFTGSTEVGRRVAEVI 263 Solibacter usita...
YP_066068   203 VCGNVLVWKPSSqVGLTAIAIQHIIARvlk--knKLPEGIFSLICGSGKdiGDLMLADTrLPLISFTGSVRTGRHAAQII 280 Desulfotalea psy...
NP_393917   179 VDGDVVIWKPSSkAALTAVAVMKVIERvl---krNNAPNIFFLMVSSGSegGDWITNDPrIPLVSFTGSVPVGKKISENV 255 Thermoplasma aci...
ZP_01854163 179 VCGDTVVWKPSEkTPLCAIACQQIVNQvah-nfpETPDGISSLLIGGAEv-GQTLAAHPdLPLISATGSIPMGRAVAETV 256 Planctomyces mar...
ZP_01886654 180 VCGNVCVWKPSSkTPLCAIACQNILAEvlk--enELPEGISSLLIGNAV--GDLMNNDQrIPLLSFTGSTKVGRRVSSAV 255 Pedobacter sp. B...
NP_518282   168 VCGDPVIWKPSEkTPLTALAVERLFLRacq-rfgEAPPHLAQVAIGAHDl-GEALARHPgVPLVSATGSTGMGRAVAQAA 245 Ralstonia solana...
NP_104106   170 VCGDAVVWKPSEkTPLTALACEAIFKRavkrfgaDAPQGLAPVLIGDRAv-GEILVDHPkVPLVSATGSTRMGRDVGPRL 248 Mesorhizobium lo...
NP_337921   166 VCGDTVVWKPSElTPLTALACQALLSRaaa--dvGAPAAVGGLLLGGAEr-GAQLVDDPrVALLSATGSVRMGQQVGPRV 242 Mycobacterium tu...
ZP_01076288 182 VCGNPILLKPSEkAPLCALAMYSIAQKvla-dmpEIPKAVCSVVIGDRQv-GEAMAASStYPLVSATGSTAMGRQVAQTV 259 Marinomonas sp. ...
Feature 1                ###                               #                                    
2JG7_A      258 QeRFGRKLLELGGNNAIIVFEDaDLNLVVPSAVFASVGTaGQRCTTTRRLMLHesvHDAVVERIAKAYKQVRIGDPWDPs 337 black porgy
YP_826328   264 AhRLGRSILELGGNNAIIVMDDaNADLVLRAVLFGCVGTaGQRCTTTRRLFLQrgiAPRIREALTRAYGQVRIGHPLDEq 343 Solibacter usita...
YP_066068   281 AgRLGKSLLELGGNNSIIISPEaDLAIAIPAVVFGAVGTaGQRCTTTRRLIIHesiYDKVRDGLTKAYKSLRIGSPLNQd 360 Desulfotalea psy...
NP_393917   256 AkRLGKSILELGGNNGAIVSDKaDIDLALRGVVFGALATaGQRCTTTRRVIVQekiYDQFLEKLKNAYSTIKVGDPREKg 335 Thermoplasma aci...
ZP_01854163 257 ArRLGRSLLELGGNNAMIVTESaDLEMTVRSALFSAVGTcGQRCTSLRRLIVHesiADKLLASLKKAYEKLPIGNPLDEg 336 Planctomyces mar...
ZP_01886654 256 AgRFGKSILELGGNNAIIISKDaDIDMSVIGAVFGAVGTaGQRCTSTRRLIIHediYEDFKNKLVSAYAQLRIGDPLDQh 335 Pedobacter sp. B...
NP_518282   246 ApRFARTILELGGNNAAIVCTSaDLALAERAIAFAAMGTaGQRCTSLRRLFVQrpvYDALVPRLTTLYARVQVGDPRDDg 325 Ralstonia solana...
NP_104106   249 AkRFARAVLELGGNNAGIVCPTaDLDMALRAIAFGAMGTaGQRCTTLRRLFVHesvYDALVPRLKKAYQSVSVGNPLETs 328 Mesorhizobium lo...
NP_337921   243 ArRFGRVLLELGGNNAAIVAPSaDLELAVRGIVFAAAGTaGQRCTSLRRLIVHrsvADDVVARVVGAYRQLAIGDPSAPd 322 Mycobacterium tu...
ZP_01076288 260 AaRLGRSLLELGGNNAMIVSKTaDLDLALRAIVFSAAGTaGQRCTTLRRLITHssvVDDLVARLVKSYASLPIGDPLVEg 339 Marinomonas sp. ...
Feature 1                                                                       #               
2JG7_A      338 TLYGPLHTKQAVDQYLAAIEQakqqGGTLVCGGKVMdr----pGNYVEPTIITGLahdaPIVHTETFVPILYVLKFkt-e 412 black porgy
YP_826328   344 TIMGPLVNRRAVDDMLDGLRRireqGGEILYGGEALe------GCYVQPTLVRARpd-mPILKEEIFAPILYLIEFdh-l 415 Solibacter usita...
YP_066068   361 NHMGPLVNQDAVANYLAAVETikdqGGEILCGGHALqgegfesGCYVAPTLVEVKsd-iPIIKEETFAPILYLIRYsgdi 439 Desulfotalea psy...
NP_393917   336 VLVGPLIDEDAVKDYEHAIDLaikqGGKLIFGGKRItikglegGHYVMPTIIEAKpd-mPIVKEETFASILYVMKYrt-i 413 Thermoplasma aci...
ZP_01854163 337 TLVGPLVDQSALETMQQALRTaeeqGGTVHFGNPLLsdi-pagGSYVHPAIVEMPgq-tEIVMQETFAPILYVMRYeh-l 413 Planctomyces mar...
ZP_01886654 336 NHVGPLIDQAATTLYADAIEKgiqqGANFVVEGAVLqgspyesGCYVKPCVAEVEnh-fAIVQEETFAPILYLIKYkt-l 413 Pedobacter sp. B...
NP_518282   326 TLVGPLIDGHAYERMQAALARaraeGGTVHGGGRVTvga-gdgAYYVRPALVEMPaq-dGVVCEETFAPILYVMPFds-l 402 Ralstonia solana...
NP_104106   329 SLVGPLIDKAAFDAMQKALTEaa-aHGGKVAGGARVeng-hpdAYYVHPALVEMPkq-vSPVTEETFAPILYVMKYsd-f 404 Mesorhizobium lo...
NP_337921   323 TLVGPLIHEAAYRDMVAALERartdGGEVIGGDRREvgs--pgAYYVAPAVVRMPsq-tAIVATETFAPILYVLTYdd-l 398 Mycobacterium tu...
ZP_01076288 340 SLVGPLVDEQSFNRMQSALEQakvqGGEVVFGGQRVtanvpagGFYVQPAIVRIAhd-aAIVQQETFAPILYVLSFde-f 417 Marinomonas sp. ...
Feature 1                                                             #                         
2JG7_A      413 EEAFAWNNEVQQGLSSSIFTKdlGRVFRWLGpkgSDCGIVNVNIPTsGAEIGGAFGGEKHTGGGRESGSDSWKQYMRRST 492 black porgy
YP_826328   416 DEAIHWHNDVPQGLSSAMFTTnvISSETFLShrgSDCGIANINIGTsGAEIGGAFGGEKETGGGRESGSDAWKAYMRRQT 495 Solibacter usita...
YP_066068   440 NQAIEINNSAHEGLSSAIFSNnlREAETFLSpwgSDCGIANVNIGTsGAEIGGAFGGEKDTGGGRESGSDAWKAYMRRQT 519 Desulfotalea psy...
NP_393917   414 EEAIEIHNSVPQGLSSSIFTTdlREEEAFLSpygSDCGLANVNTSTaGAEIGGAFGGEKDTGGGRESGSDAWKYYMRRQT 493 Thermoplasma aci...
ZP_01854163 414 ETAIQMHNAVPQGLSSAIMTNdiRQAELFLSpvgSDCGIANVNVGPsGAEIGGAFGGEKETGGGRESGSDAWKAYMRRAT 493 Planctomyces mar...
ZP_01886654 414 EEAIALQNDVPQGLSSAIMTLnlREAEQFLSasgSDCGIANVNIGTsGAEIGGAFGGEKETGGGRESGSDAWKGYMRRQT 493 Pedobacter sp. B...
NP_518282   403 DEAIALNNAVPHGLSSSLFTLdmREAERFVSatgSDCGIANVNIGPsGAEIGGAFGGEKDTGGGREAGSDAWKAYMRRAT 482 Ralstonia solana...
NP_104106   405 DAVLDEHNAVGAGLSSSIFTRdlQESERFLGvdgSDCGIANVNIGTsGAEIGGAFGGEKETGGGRESGSDAWKAYMRRAT 484 Mesorhizobium lo...
NP_337921   399 DEAIALNNAVPQGLSSSIFTTdlREAEHFLDq--SDCGIANVNIGTsGAEIGGAFGGEKQTGGGRESGSDAWKAYMRRAT 476 Mycobacterium tu...
ZP_01076288 418 EEAIEIQNNVPQGLSSAVFTEsmREAEVFMSpagSDCGIANVNIGTsGAEIGGAFGGEKETGGGRESGSDAWRNYMRRTT 497 Marinomonas sp. ...
Feature 1             
2JG7_A      493 CTINYS 498 black porgy
YP_826328   496 NTINWS 501 Solibacter usitatus Ellin6076
YP_066068   520 VTINYG 525 Desulfotalea psychrophila LSv54
NP_393917   494 VTKNWG 499 Thermoplasma acidophilum DSM 1728
ZP_01854163 494 NTINYS 499 Planctomyces maris DSM 8797
ZP_01886654 494 NTINYS 499 Pedobacter sp. BAL39
NP_518282   483 NTVNYG 488 Ralstonia solanacearum GMI1000
NP_104106   485 NTVNYS 490 Mesorhizobium loti MAFF303099
NP_337921   477 NTVNYS 482 Mycobacterium tuberculosis CDC1551
ZP_01076288 498 NTVNYG 503 Marinomonas sp. MED121

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap