Conserved Protein Domain Family
ALDH_F12_P5CDH

?
cd07126: ALDH_F12_P5CDH 
Delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH family 12
Delta(1)-pyrroline-5-carboxylate dehydrogenase (P5CDH, EC=1.5.1.12), family 12: a proline catabolic enzyme of the aldehyde dehydrogenase (ALDH) protein superfamily. P5CDH is a mitochondrial enzyme involved in proline degradation and catalyzes the NAD + -dependent conversion of P5C to glutamate. The P5CDH, ALDH12A1 gene, in Arabidopsis, has been identified as an osmotic-stress-inducible ALDH gene. This CD contains both Viridiplantae and Alveolata P5CDH sequences.
Statistics
?
PSSM-Id: 143444
View PSSM: cd07126
Aligned: 6 rows
Threshold Bit Score: 963.11
Threshold Setting Gi: 145511077
Created: 29-Oct-2008
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
NADP bindingcatalytic
Feature 1:NADP binding site [chemical binding site]
Evidence:
  • Comment:based on similarity to structure 2VRO: Aldehyde dehydrogenase from Burkholderia xenovorans Lb400 in complex with NADPH, defined using 3.5 A.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                        
Q8VZC3        55 SFVQGKWIGSsnh---ntLLDPLN---GEPFIKVAEvd-eSGTQPFVDSLSQCPKHGLHNPFKsPERYLLYGDISTKaah 127 thale cress
XP_001031541  42 NLVSGKWKDAkey---ttVVDPMN---GDKFLRVPDtk-gDEINEFIVNAKKVPKSGLHNPIKnPERYQLYGNVCGKiae 114 Tetrahymena the...
XP_001760169  70 NLVQGKWEQTsks---ieLLDPLN---GEKFISVPDts-iDEISPFVQSLRACSKSGLHNPLKnPERYLLYGDIMAKaah 142 Physcomitrella ...
XP_001441466  36 NFINGIWKCAsny---leILDPLN---GDKFILVPNnlteEEINEYRDAAIQCPKSGLHNPLKnPDRYNLYGEIFHRvsf 109 Paramecium tetr...
XP_001696928  49 NLVAGRWTGSres---rqLPDPLN---GEPFISVPHtq-vDEITPFVESLRAVPKSGLHNPLKnPQRYLLYGDVSFRvaa 121 Chlamydomonas r...
CAL53235      12 NLIAGAWREItdesratkIVDPMNkseTDAFIVLPStdtkQEIDEVARSLASCPKSGLHNAFKaPERYVMWGDVSMRlaq 91  Ostreococcus tauri
Feature 1                                                                                   ## # 
Q8VZC3       128 MLALPKVADFFARLIQRVAPKSYQQAAGEVFVTRKFLENFCGDQVRFLARSFAIPGNHLGQQSHGYRWPYGPVTIVTPFN 207 thale cress
XP_001031541 115 EMKKPEIESFLCKATQRVMPKSDVQIKGEIVVTRRFFENFAGDNPRFLCRSFNVAGDHQGQQSSGYRWPYGSVALIAPFN 194 Tetrahymena the...
XP_001760169 143 LLKQPQVETFFARLIQRVAPKSFAQAVGEVTVTQKFLENFSGDQVRFLARSFVVPGNYQGQQSNGMRWPYGPVAIITPFN 222 Physcomitrella ...
XP_001441466 110 LLGLPQVEDYFVHLIQRVAPKSDIQARGEVKVTQRFLMNFSGDQCRFLTRSFNVSGDVQGQQSSGYRFPYGHVAIIAPFN 189 Paramecium tetr...
XP_001696928 122 EMRKPAVEDFFARLIQRVAPKSYDQALGEVRVTRKFFENFTGDQVRFLARGFTNPGDHAGQTSSGTRWPYGPVALITPFN 201 Chlamydomonas r...
CAL53235      92 EFRKPEVEEYFARLIQRVAPKSHAQALAEVVVTRKFLENFAGDNVRFMARGFSVSGDHLGQQSHGLRWPYGPVAVITPFN 171 Ostreococcus tauri
Feature 1                              # ##                                              ####  # 
Q8VZC3       208 FPLEIPLLQLMGALYMGNKPLLKVDSKVSIVMEQMMRLLHYCGlPAEDVDFINsdgktMNKILLEAnPRMTLFTGSSRVA 287 thale cress
XP_001031541 195 FPIEIPCLQLFGCLIAGNRPTLKIDSKVSLVMEQFLRLAIDCGmPAEDVDLIHsgpqaMEKIILDTnYRVIQFTGSSTVA 274 Tetrahymena the...
XP_001760169 223 FPLEIPALQALGALFMGNKPILKVDSKVSIVMEQFIRLLHKCGmPPTDMDFINsdgpvMNKLLLEAePKTTLFTGSSKVA 302 Physcomitrella ...
XP_001441466 190 FPLEIPALQMMGALLAGNRLTIKGDQRVSVVLEMFLRLLHLAGlPPTDCDLIHcdgpqMESLLKKSnFRLLQFTGSSGIA 269 Paramecium tetr...
XP_001696928 202 FPLEIPALQLMGALYMGNKPLLHVDQRVSVVAEQLVRLLAHCGmPASDLDLLHgpgatVGEVIKRAePRSTLFTGSQRVA 281 Chlamydomonas r...
CAL53235     172 FPLEIPVLQLMGALFMGNKALVKSDSKVSVVLEQFIRLMIECGaPATDLDFIHsdgvtMNSILSAAkPKMTLFTGSQKVA 251 Ostreococcus tauri
Feature 1                                                                                        
Q8VZC3       288 EKLALDLkGRIRLEDAGFDWKVLGPDVqEVDYVAWQCDQDAYACSGQKCSAQSMLFVHeNWSKTPLVSKLKELAERRKLe 367 thale cress
XP_001031541 275 ERLSKLThGKVKIEDAGFDWKILGPDVsDIDYVAWQCDQDAYAASGQKCSAQSILYAHeNWMKAGFVDKIKSLAARRKLs 354 Tetrahymena the...
XP_001760169 303 EKLALDLkGRVKLEDAGFDWKILGPDVqNEDYVAWVCDQDAYACSGQKCSAQSILFMHeNWANQNFLERLKKLASKRKLe 382 Physcomitrella ...
XP_001441466 270 ERLCNVMnGKIKIEDAGFDWKILGPDViEFDYVAYQSDQDAYAFSGQKCSAQSILFAHkNWVQAGILDKIKLLAEQRSLq 349 Paramecium tetr...
XP_001696928 282 ERLAVEThGKVFLEDAGFDWKIMGPDVsNVDYVAWQCDQDAYACSGQKCSAQSILFAHsNWVQAGLLNKMAAAAAQRQLs 361 Chlamydomonas r...
CAL53235     252 HHLARELeGNVKLEDAGFDWKILGPDVgDVDYVAHVCDQDAYACSGQKCSAQSILFMHkNWVDVGIESKLAALAGERNLe 331 Ostreococcus tauri
Feature 1                                                                                        
Q8VZC3       368 DLTIGPVLTFTTEAMLEHMENLLQIPGSKLLFGGKeLKNHSip--siYGALEPTAVYVPIeeilkdnKTYELVTKEIFGP 445 thale cress
XP_001031541 355 DLTVGPVLTWDNQKIKNHIDSILALPGAKVLFGGKpLTNHSip--siYGSYEPTAIFVPLet---isKNFDIVCKELFGP 429 Tetrahymena the...
XP_001760169 383 DLTVGPVLTVTTERMLDHVKNLLAIPGARVEFGGKpLTNHTip--dvYGALEPTAVFVPLkeilrneENFALATTEIFGP 460 Physcomitrella ...
XP_001441466 350 NLTICPILTWNNQRIQTHLDKLLAIQGAKVLFGGKpINEQHkip-ecYGSYLPTAVYIPLqq---ikENFELVTTEVFGP 425 Paramecium tetr...
XP_001696928 362 DLTIGPVLTWTTEAILAHTNKLLQIPGAKVLFGGKpLTGHSip--avYGAVQPTAVFVPLvea-lkpEHFGTVTTEVFGP 438 Chlamydomonas r...
CAL53235     332 DLTVGPVLTLTTKTMLDHVDRLAALPGARVAFGGKeLKDGNhsipsqYGAIEPTAVFVPLktimaseENFKLVTTEFFGP 411 Ostreococcus tauri
Feature 1                                                                                        
Q8VZC3       446 FQIVTEYKkdqLPLVLEALERMHAHLTAAVVSNDPIFLQEVIGNSVNGTTYAGLRGRTTGAPQNHWFGPAGDPRGAGIGT 525 thale cress
XP_001031541 430 FQIVTEYKdnqLDTVLSHLEKMENHLTAAVVSNDVKFLNYVTSNTVNGVTYTGIRARTTGAPQNHWFGPCGDPRGAGIGT 509 Tetrahymena the...
XP_001760169 461 FQILTEYKhedLPLVFEACERMHAHLTAAVVSNDVHFLQEVLSNTVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIGT 540 Physcomitrella ...
XP_001441466 426 FQVVTEYEn--EDHVIEILENIPHNLTAGVVSNDIRFVQKILANTINGVTYAGIKARTTGAPQNHWFGPCGDPRGTGIGS 503 Paramecium tetr...
XP_001696928 439 FQVVTEYGdgqLPLVLEACERMTHHLTAAIVSNDINFIQHVLAHTVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIGT 518 Chlamydomonas r...
CAL53235     412 MQVLTSYDdeeLPLVLDACERMDAHLTAAVVSSDEMFSQRVLGSTVNGTTYAGRRARTTGAPQNHWFGPAGTPMAGGIGT 491 Ostreococcus tauri
Feature 1                           
Q8VZC3       526 PEAIKLVWSCHREVIYDYG 544 thale cress
XP_001031541 510 PEAILSVWTSHREIITDID 528 Tetrahymena thermophila SB210
XP_001760169 541 PEAIKLVWSCHREIIQDVG 559 Physcomitrella patens subsp. patens
XP_001441466 504 PEAIVQTWTTHREIIMDIG 522 Paramecium tetraurelia strain d4-2
XP_001696928 519 PEAIRMVWSCHREIITDFG 537 Chlamydomonas reinhardtii
CAL53235     492 IEAIRLVWSCHREIIFDRG 510 Ostreococcus tauri

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap