Conserved Protein Domain Family
ALDH_PutA-P5CDH

?
cd07125: ALDH_PutA-P5CDH 
Delta(1)-pyrroline-5-carboxylate dehydrogenase, PutA
The proline catabolic enzymes of the aldehyde dehydrogenase (ALDH) protein superfamily, proline dehydrogenase and Delta(1)-pyrroline-5-carboxylate dehydrogenase (P5CDH, (EC=1.5.1.12 )), catalyze the two-step oxidation of proline to glutamate; P5CDH catalyzes the oxidation of glutamate semialdehyde, utilizing NAD+ as the electron acceptor. In some bacteria, the two enzymes are fused into the bifunctional flavoenzyme, proline utilization A (PutA) These enzymes play important roles in cellular redox control, superoxide generation, and apoptosis. In certain prokaryotes such as Escherichia coli, PutA is also a transcriptional repressor of the proline utilization genes.
Statistics
?
PSSM-Id: 143443
View PSSM: cd07125
Aligned: 33 rows
Threshold Bit Score: 631.153
Threshold Setting Gi: 25026657
Created: 14-Jan-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
Feature 1:NAD binding site [chemical binding site]
Evidence:
  • Comment:based on similarity to structure 2BJA: 1-Pyrroline-5-Carboxylate Dehydrogenase with bound NAD from Thermus thermophilus.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                         
NP_719311     486 ANTSFVHKLVDPKTPieslvvhplktltsyktlannkiv-----------------------------lpidifgsdrkn 536  Shewanella on...
YP_001878657  440 SEENFLHDLFGMTPGsrswevqkkrflkacqekdevkygpnrtq------------------nraadpiqpshyrdafan 501  Akkermansia m...
YP_007032     439 APENFLRHAFDLRPGtddwnnqvhlfkqacqnyeqvsdqprrlq-------------------nrlhkdrllnqrkcfqn 499  Candidatus Pr...
ZP_03130927   425 GPDNFLRHAFRLHVGteewnalergfreafhlgisdaprrtqnrtvphnetareeapwmelvnepdtdfalpqnsdwaeq 504  Chthoniobacte...
EDY80889      422 SPQNFLTHSFNLEPGdedwtflanqfrfsfgridrlkseafrtqnrl------------nekssalqttfgndrfkdepd 489  Verrucomicrob...
EDZ62799      424 AEQNFLRHSFGLEVDtpewerlvgsykksiemlddieliphrtqdrn-------------seefinaigdevyefknepd 490  Campylobacter...
YP_250229     425 AKQNFLYALFTPEDDetdvtgmtpmqgqelrfrnsvr--------------------------------drwetfagsrr 472  Corynebacteri...
NP_868270     450 GAENFLRHAYRLQPDspdfellagrfkdalmdcetvsvqprrtqnry------------qtpvqppaaehwtqfvnepdt 517  Rhodopirellul...
NP_222770     416 SSDNFMKAFFNLKVGtsewkdqeqrflnslkgiatldntthrtqd----------------rnakqtghttypnhsfkne 479  Helicobacter ...
NP_736711     540 ASENFMSVIFDLEADnpafrreesrfrasiedlaglidapvp-----------------------gpndtqdrgaqeaet 596  Corynebacteri...
Feature 1                                                                                         
NP_719311     537 skglnmniiseAEPFFAALDKFKst--qWQAGPLVNGqpl-------------tgEHKTIVSPfd---ttQTVGQVAFAd 598  Shewanella on...
YP_001878657  502 erdtdwslrqnAEWINGLIAAEKek--sGEEIPLVIDgeei-----------ttnLWGVGRDPsr---hnEVSYKFAYAd 565  Akkermansia m...
YP_007032     500 vadtdwslshnRQWAKIIIDQWKnk--kHPDVPLVINgfhyts-------enrwgIGEDPSFPg------KILYRYALAs 564  Candidatus Pr...
ZP_03130927   505 ivhaegprsveIQNRDGALTEQLppnesLPRIPLVLGgeti-----------rnrETRPCLDPsr---pgVTLCDYALAt 570  Chthoniobacte...
EDY80889      490 tdwtlaanrewAGMIREKWKAKPdg--rVVEIPISVGeefl----------yenlDTAGIIDHsqh-ekqIPIARYALAr 556  Verrucomicrob...
EDZ62799      491 tdfalasnirwAEKIRDKWKNIGan--gGYHASSVIGgktl-----------ehgDAIEVIDKsqy-henVVLGSYKKAa 556  Campylobacter...
YP_250229     473 tqnrlkeeaekKGCQSDGLPGNFvn--ePDTDPTLPAnr---------------eWALKIVDPssd-pgpAQTPEVTDP- 533  Corynebacteri...
NP_868270     518 dwslphnskwaQETLDRWKPLCDeq--aTRVTPVLVGlpdvdsldgddrvsaewfTTDDVSRPg------VVTCRYKNA- 588  Rhodopirellul...
NP_222770     480 sdtdfilkanrEWAKKVRDKMHNap--iLELYPEIDGrfed-----------pnlTPLEVFDRih----hKKIASVHLAd 542  Helicobacter ...
NP_736711     597 leaagerarelEAARAPDQLPPFan--ePDTNPALTAnq--------------qwARAAIKRSagegwleQQTAPLSVEe 660  Corynebacteri...
Feature 1                                                                                         
NP_719311     599 kAAIEQAVSSAHAAFGSWTr-tPVEVRASALQKLADLLEENREELIALCTREAGKSIQDGIDEVREAVDFCRYYAVQAKK 677  Shewanella on...
YP_001878657  566 fDQVEHALVTADRVRSSWAs-kSIGERAEILHRAAQELSRIRGEAIAAMVRDAGKAPTEADVEVSEAIDFCRYYAEGLDR 644  Akkermansia m...
YP_007032     565 kEQVDEALDAAQNAYLKWSa-tTSQERANLLIKIAQGLELHRADLIGAMIADTAKTLIEADIEVSEAIDFANYYRFNLLE 643  Candidatus Pr...
ZP_03130927   571 dDDVDRAVAAAHADVTGWRs-lSHQARSAILGTVAAELRKARGALMWAALANGGKTLTESDPEVSEAIDFLEFYRASARE 649  Chthoniobacte...
EDY80889      557 iEDIDRAMEIAAGDESGWAe-mTLAQRHEVLSAAAQELRQARGDLIGVAAAEVGKLFGETDTEVSEAVDFAEFYPFAMQG 635  Verrucomicrob...
EDZ62799      557 iQDLEDAVEIAKDDPDGWRk-tSINYREKILMSVANEFKKDRADLIGIAAAEVGKVFSETDVEISEAIDFLNFYPYSVQK 635  Campylobacter...
YP_250229     534 -AVIDAAVARCREASAQWSq-kTGAERAELLDQAAHALANNRSKLISAAVFEAGKTVAETDPEVSEAIDFARYYAESARQ 611  Corynebacteri...
NP_868270     589 -TSPAVESAVRASSESTWAadlSVDERYSVLRSVAQLARERRGDWIGSMVAGAGKTVAEADPEVSEAIDFLEFYPLTMKA 667  Rhodopirellul...
NP_222770     543 kEAILKALEVAKSDKSRFSq-kSFTEIHALLSQTAQLFRERRGDLIGISALEVGKTFAETDAEVSEAIDFLEFYPYSLRV 621  Helicobacter ...
NP_736711     661 -EDIDALIEGTRAAAAEWAa-lPPMERARILYRTADILAARRGHLVSIAAAEVGKVVEQTDPEISEAIDFARYYAHRALE 738  Corynebacteri...
Feature 1                                     ##                         # ##                     
NP_719311     678 lmskpellpgpTGELNELFLQGRGVFVCISPWNFPLAIFLGQVSAALAAGNTVVAKPAEQTSIIGYRAVQLAHQAGIPTD 757  Shewanella on...
YP_001878657  645 -----------DGMNDGVEMSPLGIICVMSPWNFPFAIPTGGVAAALMAGNAVVFKPSELAVYTAWQIVQAFWRAGVPKN 713  Akkermansia m...
YP_007032     644 -----------WMYLEDVKWSAKGVVVIAPPWNFPCSIAAGGILAALVTGNTVILKPAFESVLVCWHLAQIFWEAGISQQ 712  Candidatus Pr...
ZP_03130927   650 -----------FFELPTLEARALGVVVVVPPWNFPIAIPCGGMAAALAAGNTVILKPASDTVLVAWELCQCFWRGGVPRE 718  Chthoniobacte...
EDY80889      636 -----------FVERKNLEFRGKGVGVIIPPWNFPIAIPAGGVLASLAAGNNTILKPSPQAAYCGWLICQALWKTGVPRK 704  Verrucomicrob...
EDZ62799      636 -----------ISKLEGVKLSAKGVGLVVSPWNFPIAIAVGGIAAALASGNTVILKPASVSVLCAHRLCECFWRAGISKN 704  Campylobacter...
YP_250229     612 -----------LDHVRGSVFTPYKSVVVTPPWNFPIAIPLGGVFAALAAGSCVIIKPAPQVLRIAEVFMEILREAGISED 680  Corynebacteri...
NP_868270     668 -----------WDECAGIQCEPRGVVAVITPWNFPLAIACGGIAAAIAAGNPVVVKPSMQTLLPAWLMCQAFWDAGVPRD 736  Rhodopirellul...
NP_222770     622 l----------QEQNKKTKFTPKGVGVVIAPWNFPVGISVGTIAAPLAAGNRVIYKPSSLSSVTGYKLCECFWDAGVPRD 691  Helicobacter ...
NP_736711     739 -----------LEQVDNADFTPDRVAVITPPWNFPIAIPAGSTFAALAAGAGVIHKPSKPSQHCSAAVVEALWEAGVPRR 807  Corynebacteri...
Feature 1                 #                 #  #  #                                               
NP_719311     758 VLQYLPGTGAtVGNALTADErIGGVCFTGSTGTAKLINRTLAnregaIIPLIAETGGQNAMVVDSTSQPEQVVNDVVSSS 837  Shewanella on...
YP_001878657  714 VLQFVPMPRNeISCKFLMDPrLNGVIMTGSYRTGKMLRELRP-----DLHVLAETSGKDAMIITATADPDQAVKDLVKSA 788  Akkermansia m...
YP_007032     713 VLQFVVCEDEpVGSALIQDSrVNAVVLTGATETAKLFLRLRA-----DLDLMAETGGKNTMIITSMADRDLAIKDLVQSA 787  Candidatus Pr...
ZP_03130927   719 VLQFVPCPGSgAGQRLVTHPhVDAVILTGGTATALHLLQARP-----DLRLFAETGGKNATIVTALADREQAIKHVLHSA 793  Chthoniobacte...
EDY80889      705 ALQFLPCRNDpEASHLAAHPkTAFVIFTGSTRTALKMLQKRS-----QLPLYAETGGKNAMIISSMADRDKAIADVIQSA 779  Verrucomicrob...
EDZ62799      705 TLQLVITDGErAGEHLIPNPdIDFVIFTGGESTAYEMLKKCP-----SLHLSAETGGKNATIVTSLADRDQAVKNVIQSA 779  Campylobacter...
YP_250229     681 LVQLVNADEAeAGKRLVSHPdVESVILTGASETAKLFRGWKP-----RMVINAETSGKNAIIVTPAADPDLAVADIFKSA 755  Corynebacteri...
NP_868270     737 ALQFVICDDEvAEEQLVKNPiVDTVILTGGTSTAKRMLDVRP-----DLHLLAETGGKNVTIVTAMADRDLAIKHVLHSA 811  Rhodopirellul...
NP_222770     692 ALIYLPSKGSdISEHLLKDEsIKFAILTGGEDTAYKMLKANP-----TLALSAETGGKNATIVSKMADRDQAIKNVIHSA 766  Helicobacter ...
NP_736711     808 VLHCVYPANReAGRRLVSHPeVDRVILTGSSETAAMFASWRP-----DLQINAETSGKNAMVITPAADRDLAVADLVHSA 882  Corynebacteri...
Feature 1                                                                                         
NP_719311     838 FTSAGQRCSALRVLFLQEDI--ADRVIDVLQGAMDELvIGNPSSIKTDVGPVIDATAKANLDAHIDHIKqVGKLIKQMSL 915  Shewanella on...
YP_001878657  789 FGHSGQKCSAASVAIVEASVydNPAFLRQLKDAAASLkVGGSWEVNSVVTPLIREPEGNLLRALTQLEPgEEWLLKPEPS 868  Akkermansia m...
YP_007032     788 FSHAGQKCSACSLAIVEAETydNLHFRQQLKDSVESLsIGSPWKLKSKVNPLIREANPNLLRGLTQLEEgEEWLVQPKQD 867  Candidatus Pr...
ZP_03130927   794 FSHSGQKCSATSLLLLEAEVydDPAFQRMLVDAVRSLhVGSAWDLETKIGPLIRPPAGELARALTALEPgESWAVEPLQV 873  Chthoniobacte...
EDY80889      780 FGNSGQKCSATSLVLLQRSLfeDKSFRAALVDAAKSLpVGYAWEFKSKFGPLANPLGGPLKKVIDTIGEgEEWVLKPEVS 859  Verrucomicrob...
EDZ62799      780 FNNSGQKCSATSLLILEKELyvDKKFRAMLLDAAESLeVGSVWDFKNKIGTLSSKVSGNLAKSLEFLSEdEEWLLKPSYA 859  Campylobacter...
YP_250229     756 YGHAGQKCSAASLIITVGSIgkSKRFINQLVDAVRSMkVGPGSDISTFMNGVIEEPGDKLLRGLTELDKgEKWLVKPRKL 835  Corynebacteri...
NP_868270     812 FGHSGQKCSATSLLLLENEVfdDPEFREILADAVRSLpVGSAWDLHTRVTPLVDPPTDKLRRGLQELEGgESWLVMSEHV 891  Rhodopirellul...
NP_222770     767 FSNSGQKCSATSLLVLEKEVyeDENFKKTLIDATLSLsVGDPFDFKNKIGALADKPNEKVIKAIDELKSyENYEIPASFV 846  Helicobacter ...
NP_736711     883 FGHAGQKCSAASLGILVGTMytSERFRSQLVDAASSLvVDWPTNMSATVGPLTEQPSDKLQHALTQLEPgERWLLEPKPL 962  Corynebacteri...
Feature 1                                                                                         
NP_719311     916 PagtenGHFVAPTAVEID--SIKVLEKEHFGPILHVIRYKasELAHVIDEINSTGFGLTLGIHSRNEGHALEVADKVNVG 993  Shewanella on...
YP_001878657  869 Ed---nPCLWSPGIRLGVkpGSWFHQTECFGPVLGIIRAE--NLEEAIDIQNDSEFGLTGGLQSLDEREIALWKTKVQVG 943  Akkermansia m...
YP_007032     868 Pq---nPYLWSPGIKLGVkpGNFTYNTELFGPVLGLVRAE--NFDEALHMMNQTGYGLTAGIHTLDEREQKQWFQKIEAG 942  Candidatus Pr...
ZP_03130927   874 Gd---nPHLWSPGVKWDVqpGSITHHTEFFGPLLGVIRFT--KLSEAISLVNATGYGLTSGLESLDEREQAEWRDGIRAG 948  Chthoniobacte...
EDY80889      860 Es---dPHMVTPGILWNVtqSSFCYRKELFGPVIGVMRYD--TLEEAIRLVNETDYGLTSGIHSLDEREIAKWREEIRAG 934  Verrucomicrob...
EDZ62799      860 Den--nPYLLKPSIRWGThpGGFTHLNELFGPVLSVMSAD--DIYEAIEIVNETGYGLTSGIESLDEREQKIWREKIKAG 935  Campylobacter...
YP_250229     836 Nd---eGTLWSPGLRDNVkpGSWFHTHECFGPVAGIMHAE--TLDEAIEWQNSTGFGLTGGIHTIDVDETAYWRERVEVG 910  Corynebacteri...
NP_868270     892 Dg---nPTLYRPGVKWDVqpGSFTHTTELFGPVMGVMRFG--RLEEAIEIVRSTGYGLTSGLESLDDREIKLWRESIPAG 966  Rhodopirellul...
NP_222770     847 Dd---nPYLMKPSIKYGTkkGDFTHQTELFTPILSVMKAK--DLDEAIEIVNSTGYGLTSALESLDEREWEYYLERIEAG 921  Helicobacter ...
NP_736711     963 Dd---tGRLWRPGIKEGVqpGSFFHLTEVFGPVLGLMKAD--DLEQAIEYQNAVEFGLTGGIQSLDIDEVRTWVDAVEVG 1037 Corynebacteri...
Feature 1                                                                      
NP_719311     994 NVYINRNQIGAVVGVQPFGGQGLSGT--GPKAGGPHYLTRFVTEKTRTNNITAIGGNATLL 1052 Shewanella oneidensis MR-1
YP_001878657  944 NAYINRVITGAIVRRQPFGGWNHSSMgpGAKAGGPNYLTMLGSWEEKALPQKLRTPGERIS 1004 Akkermansia muciniphila ATCC BAA...
YP_007032     943 NCYINRTMTGAIVERQPFGGCKESSFgkGSKAGGPNYLVQFMQTSQKNLPTEQKELKEMPL 1003 Candidatus Protochlamydia amoebo...
ZP_03130927   949 NLYINRGTTGAIVLRQPFGGVGKSSFgpGMKAGGPNYVAQFQSFTERQTATNNRLVQQPRL 1009 Chthoniobacter flavus Ellin428
EDY80889      935 NLYINRGTTGAIVLRQPFGGMAKSAIgpGVKVGGWNYPLEFCDAVENGLPRDRRPNDPLLT 995  Verrucomicrobiae bacterium DG1235
EDZ62799      936 NLYINRMTTGAIVTRQPFGGMGKSAIgsGKKAGGFNYVAQFMDIAHDITPLTQKSNHPYLQ 996  Campylobacterales bacterium GD 1
YP_250229     911 NAYVERGITGAIVQRQSFGGWKNSALgsGAKAGGPNYVAQQGVWTEGDLSELAAGTLPTHI 971  Corynebacterium jeikeium K411
NP_868270     967 NLYINRPTTGAIVLRQPFGGVGLSAYgpGIKAGGPNYVLALSKVTHASDWTPPTDEVEASH 1027 Rhodopirellula baltica SH 1
NP_222770     922 NIYINKPTTGAIVLRQPFGGVKKSAVgfGRKVGIFNYITQFVNIHQEEEDENALKNPLSEA 982  Helicobacter pylori J99
NP_736711    1038 NVYVNRGITGAIVERQSFGGWKKSSVglGSKAGGPNYVMLMGRWSDKPAKDAPVKSSPLIN 1098 Corynebacterium efficiens YS-314

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap