Conserved Protein Domain Family
ALDH_F4-17_P5CDH

?
cd07123: ALDH_F4-17_P5CDH 
Delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH families 4 and 17
Delta(1)-pyrroline-5-carboxylate dehydrogenase (EC=1.5.1.12 ), families 4 and 17: a proline catabolic enzyme of the aldehyde dehydrogenase (ALDH) protein superfamily. Delta(1)-pyrroline-5-carboxylate dehydrogenase (P5CDH), also known as ALDH4A1 in humans, is a mitochondrial homodimer involved in proline degradation and catalyzes the NAD + -dependent conversion of P5C to glutamate. This is a necessary step in the pathway interconnecting the urea and tricarboxylic acid cycles. The preferred substrate is glutamic gamma-semialdehyde, other substrates include succinic, glutaric and adipic semialdehydes. Also included in this CD is the Aldh17 Drosophila melanogaster (Q9VUC0) P5CDH and similar sequences.
Statistics
?
PSSM-Id: 143441
View PSSM: cd07123
Aligned: 30 rows
Threshold Bit Score: 861.123
Threshold Setting Gi: 67904582
Created: 11-Dec-2008
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
Feature 1:NAD binding site [chemical binding site]
Evidence:
  • Comment:based on similarity to structure 2BJA: 1-Pyrroline-5-Carboxylate Dehydrogenase with bound NAD from Thermus thermophilus.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                        
P30038        32 VANEPVLAFTQGsp--eRDALQKALKDLKg-rMEAIPCVVGDEevwTSDVQYQVSPFn-HGHKVAKFCYad-ksLLNKAI 106 human
XP_682547      9 PGNADGLSYGPGsa--eRDLLKSALAEMEs-vVTDIPSIINGEriyTGRKGKQANPWnnHGQPLAEYYEvdsntVTEKAI 85  Aspergillus nid...
P78568        14 VSNEPMLSYAPGsp--eRAGLQAALAEMQsqlPFEVPCIINGQevrTNNIQKQPMPHd-HARHLCTFHEgs-peLVEKAT 89  common mushroom
Q9P8I0        35 IDNEPNKHYAAGsp--dRKALQEALARTQrnaPLSVPLVIAGKevkSSSSLTQSNPA--SHGPVATYSNat-akDVQAAI 109 Emericella nidu...
XP_001208681  39 FVNEQPLDYAKGsp--eRAKLTQALEKLKgelPVQVPIQISGStvaTHGSRKQENPSr-HREIVAEYATag-peQVNAAV 114 Aspergillus ter...
NP_493946     32 KTNEPILEYRKGsk--eRQDLEAALAFYSk-nITEVPLRIGDKkitNKLEQKQVIPSd-HRSTLAKYTYat-geQIQEAI 106 nematode
XP_001632461  24 PPNEPLTDVGAK-----RSKIDAAIKKVQs-eTVELPVLCGGEkvyTGNVKYQVSPFd-HSNKIAKYHVad-eaLVKETI 95  starlet sea ane...
XP_001391583  42 ARNEPNLDYTRGsp--eRAEVEKVLKQMKsqlPLKSQSYVGGKalsVSNTLQQPLPAe-HATTFTNYPSvn-aaQVNAAI 117 Aspergillus nig...
XP_639145     21 PVNQPMLNYEVGst--hRKLLKEACAKFRn-tTIDIPCVVGGKeirTGDVQKQLICSd-HNKVLATFHQan-aeLLKLAV 95  Dictyostelium d...
XP_001744962 157 VYNEPVWDYVKGvdddnRANIREACQVVRn-eTVDIPCVINGEeiySGNTVDQLAPSq-HELTIARIHHad-eaMIKRAI 233 Monosiga brevic...
Feature 1                                                                                        
P30038       107 EAALAARKEWDlKPIADRAQIFLKAADMLSGPRRAEILAKTMVG-QGKTVIQAEIDAAAELIDFFRFNAKYAVELEGQQP 185 human
XP_682547     86 PGALEARKVWAnMPFRDRAAIYKRAALLVETPKYRWKLMAAAMIgQGKTCGQAEGDCITEVIDTLNFHVYFCAQLYQQQP 165 Aspergillus nid...
P78568        90 CGALQAKDGWEtMPWNDRAAIFLKAADLASGKYRYKLMAATMLG-QGKNTWQAEIDAAAELADFFRFGVSYVEELYAQQP 168 common mushroom
Q9P8I0       110 ESALEARKSWAsTPFADRASVFLKAADLISTKYRYDVMALTMHG-QGKNAWQAEIDSAAELCDFFRFGVKYAEDLYAQQP 188 Emericella nidu...
XP_001208681 115 EAALKAKPAWEaMPFEDRAAIFLRAAELVTGKYRADIVAATMLG-QGKNIWQAEIDAPAETADFFRCYVQECWSLYGQQP 193 Aspergillus ter...
NP_493946    107 DVALQARGAWErKPLKERAEILLRAADLAAGKYRMKLNASTMLG-QGKNIIQAEIDAACELIDFFRFNAVFAMELEHYEP 185 nematode
XP_001632461  96 KRAVAARKAWDrTPFEERAKILLKVADMISGKYRFETIANTMVG-QGKTVFEADIDAIAELADFYRFAVHYAREMLQGPE 174 starlet sea ane...
XP_001391583 118 DAALEAKEAWQnTPFVDRAAIFLKAAELVAGKYRYELIAATMLG-QGKNIWQGEIDAAAELADFFRLNCNYAAELLEKQP 196 Aspergillus nig...
XP_639145     96 ENSMESKAQWEsLPFEARSAVFLKAADLLNTKYRYDVLASTMLG-QGKTVWQAEIDAAAEGIDFLRFNVKYAQEIYQQQP 174 Dictyostelium d...
XP_001744962 234 DGAVEARKEWElMPWEHRAAVFLRAADMLTTEYRFRALATTMIG-QGKNVYQAEIDAAAEAADFFRFGVHYANEILHQQP 312 Monosiga brevic...
Feature 1                              ##                        # ##                            
P30038       186 Isvp-pstNSTVYRGLEGFVAAISPFNFTAIGGNLAGAPALMGNVVLWKPSDTAMLASYAVYRILREAGLPPNIIQFVPA 264 human
XP_682547    166 PkqfasssSKLDYRPLEGFVLAVSPFNFTALGAHIALTPAILGNVVLWKPSPMAVLSNYILYQIMEEAGLPKGVVQFLPV 245 Aspergillus nid...
P78568       169 PknapgcwNRTEYRPLEGFVLAVSPFNFTAIGGNLPGSPALVGNVVVWKPAPAATYSNYLVFKILSEAGVPPGVIQFIPG 248 common mushroom
Q9P8I0       189 VhhapgvwNRVEYRPLEGFVYAISPFNFTAIGGNLAGAPALMGNVVVWKPSPSAIASNWLVHQILLEAGLPKNVIQFVPG 268 Emericella nidu...
XP_001208681 194 RvqaegtwGKLEYRPLEGFVYAVAPFNFTALGATLVGPAALLGNVVIWKPSDSALHASWLLHRILLEAGLPKDVIQFLPG 273 Aspergillus ter...
NP_493946    186 Istk-itkNTMQFRGMEGFVAAIAPFNFTAIGGNLPTAPALMGNVSLWKPSNTAVLSNYIIYELLEEAGMPPGILSFLPS 264 nematode
XP_001632461 175 LhqpkgvsNKLQYRGLEGFVAAVSPFNFTAIGGNLAGTPALMGNVVLWKPASTAILSQYRVMEMFQEAGLPDGVINFVPS 254 starlet sea ane...
XP_001391583 197 DrgtegmwTRVDYRPLEGFVYAVSPFNFTAIGGNLISGPALMGNVVVWKPSDSNVYASELVYKILLEAGLPPNVIQFVTG 276 Aspergillus nig...
XP_639145    175 PansagcwNILTYQPLEGYVVAISPFNFTAIGLNLSSAPALMGNVVLWKPASTAVLSNWIVYKALLEAGLPAGVIQFLPG 254 Dictyostelium d...
XP_001744962 313 EhhaahvwNRLTYRALEGFVAAVPPFNFTAIGANLGACPAIMGNSVLWKPTETAALSNFTIFQILREAGIPDGVIQFVPS 392 Monosiga brevic...
Feature 1                            #  #  #                                                     
P30038       265 DGPl-FGDTVTSSEhLCGINFTGSVPTFKHLWKQVAQNLDr--FHTFPRLAGECGGKNFHFVHRSA--DVESVVSGTLRS 339 human
XP_682547    246 ADPttVVDPALSSRdFAGLHYTGSSVVLRSLCARIGVNTHi--YRNLPRVVGESGGKNFHLVHNSCkdDVDWLASAAVRS 323 Aspergillus nid...
P78568       249 GAE--IVQAAIQSPnFRSLHFTGSTNVFKSLWKDISSNLDk--YKVYPRIVGETGGKNWHVIHKSA--EVRNAVLQSVRG 322 common mushroom
Q9P8I0       269 EAEe-VTKTVLDHPdFAALHFTGSTNVFRNLYGQISTRVAagkYRSYPRIVGETGGKNFHLIHKSA--DIRNAAVQTVRG 345 Emericella nidu...
XP_001208681 274 DAEv-VTNTLLQRPeFAALSFIGSTQVFKGLQKKIGAGVGqgiYNSYPRVVGETGGKNWGLVHPSA--NIKNAVLNTIRA 350 Aspergillus ter...
NP_493946    265 DGPv-FGDVITASPhLSAVNFTGSVPTFKTIWRKVAENLDn--YVTFPKLIGECGGKNFHFVHPSA--HVDAVAAGTARS 339 nematode
XP_001632461 255 SGSt-FGNAMTTSPhLAAVNFTGSVDTFKRIWRMVTDNLDt--YRTYPKLVGECGGKNYHFVHMSA--DLDVVVNSTIRA 329 starlet sea ane...
XP_001391583 277 DAQe-ITQTVLGRReFGGLNFTGSSDVFRSLYAQVGENIGkkvYRDYPRLVGETSGKNFHLVHPTA--DIQSAVYHTLRG 353 Aspergillus nig...
XP_639145    255 SGRl-VGEHLFNNRnFSGLHFTGSTGVFNDIYKKTADNLVagvYKGYPRIVGETGGKDFHFLHNSG--DVENFVNNTLRG 331 Dictyostelium d...
XP_001744962 393 YGPt-FGDTVAADPrLAAINFTGSTKTFDHLTQLVASRVSt--YNTYPRLIGECGGKNFHWLHESA--DVEDTVNGTIRS 467 Monosiga brevic...
Feature 1                                                                                        
P30038       340 AFEYGGQKCSACSRLYVPhs--lWPQIKGRLLEEHSRIKVGDPAEdfgTFFSAVIDAKSFARIKKWLEHARss-psLTIL 416 human
XP_682547    324 AYEFQGQKCSALSRFYVPrslwdQGDLKKALLREAAKMTHGDDVKdlhHPLGPLVSQEAFQRFQQFVDRAQsd--gHELV 401 Aspergillus nid...
P78568       323 AFEYQGQKCSALSRLYVSrs-vwENGFKTQYLEEIAKIKVGPCLDw-nNYMGPVIGRRAYDNITGFIKKAKee--gGEVL 398 common mushroom
Q9P8I0       346 AFEYQGQKCSATSRVYVAss--iADSFLEQVASEAKSLKVGPPSDf-tNFCGPVIHEASFTKLAKVIDEAKnd-peLELL 421 Emericella nidu...
XP_001208681 351 AFEYQGQKCSANSRLYVAes--aWPEFKRLLQAQLSKLTVGPVDEy-nHFVNAVIHERAYDRLAEVLHAARsd-peLELV 426 Aspergillus ter...
NP_493946    340 AWEYSGQKCSACSRMYAPks--iWPKILEKISAIHKEIKLGDVRDg-sVFLSAVIDDKAFARLKAYIDFAKtgadgANVV 416 nematode
XP_001632461 330 AFGYQGQKCSACSRLYVPks--rWPEIKEALLAELKTAKMGSPVDidnTFMTAVIDEASFDNIKTYLDFCKss-deITVL 406 starlet sea ane...
XP_001391583 354 AFEYQGQKCSATSRLYLPes--rAQEFLEKLKSEIKEITIGSPEEm-gAFMGPVIHKASFEKIKSVIDASNkd-psLELI 429 Aspergillus nig...
XP_639145    332 AFEYQGQKCSACSRAYIPqs--lWPQIKDRLVTGVKSMKMGQSDDf-sSFVSAVIDKNSFNNIQSYIEHAKas-pdAEII 407 Dictyostelium d...
XP_001744962 468 AFEYQGQKCSACSRVYVPrs--lWPEYKAGMIEALKELRVGQPDEf-sSFMTAVIDEKSFDKISGYIEHARqs-ddYEIL 543 Monosiga brevic...
Feature 1                                                                                        
P30038       417 AGGKCDDSvGYFVEPCIVESKDPq--EPIMKEEIFGPVLSVYVYPDd---KYKETLQLVDSTTs-YGLTGAVFSqDKDVV 490 human
XP_682547    402 YGGKTDGSrGFFVQPAIFMASDGdsdSELMTTELFGPLFAVQTYDDssptGFEKVCELIDKTSe-YGLAGSVFSrDRMAI 480 Aspergillus nid...
P78568       399 IGGSGDDSkGFFIQPTVILTKVPr--STTMVGEIFGPVVTAYVFEDs---DYEKTLELIDTTSi-YGLTGAIFAsERQAL 472 common mushroom
Q9P8I0       422 AGGSYDSSkGWYIQPTVYRTTNPd--HPLLTRELFGPILVVYAYPDateaDFARIAQKIDATGe-YGLTGSVFAqDREAL 498 Emericella nidu...
XP_001208681 427 AGGHASKDeGYYVHPTVYRTTNPr--HDLMQRELFGPILTVYVYPDh---DWESTLDLVNTTSp-YALTGSIFAtDVAAT 500 Aspergillus ter...
NP_493946    417 LGGKCDDKtGYFIEPTLITVTDPk--SKLLTEEMFGPVVTVLVYEDs---KVDEVLATVKDATp-YGLTGAVFSqDKEFL 490 nematode
XP_001632461 407 AGGNCDKSvGYFVEPTIVETSNPy--NKMMKEEIFGPVVCAYVYPDe---KYKEMMDVVDNTNe-FSLTGAIFGeDPTFI 480 starlet sea ane...
XP_001391583 430 AGGTYDGStGYYVHPTVYRAKDPn--HELFDKEIFGPVLAVYVYPDa---EWSSVLKTVDQSGggFALTGAVFAgDRRAI 504 Aspergillus nig...
XP_639145    408 VGGKCDSSvGWFVEPTIILAKDPh--YKSMEEEIFGPVLTIYVYEDs---KFEETLKICDETSp-YALTGSIFStCRYAI 481 Dictyostelium d...
XP_001744962 544 FGGECDKStGYFIQPTMIQTTDPk--SRLMQEEIFGPVVTAYVYEDe---DWESCLQTVNETSp-YGLTGAVYArDRSVI 617 Monosiga brevic...
Feature 1                                                                       
P30038       491 QEATKVLRNAAGNFYINDKSTGSIVGQQPFGGARASGTNDKPGGPHYILRWTSPQVIKETHKP 553 human
XP_682547    481 RVADEKLRDSVGMFCINDKSTGAIIGAHPFGGARSSGTNDKANSVNVLLRFSSIRCVKDTYVT 543 Aspergillus nidulans FGSC A4
P78568       473 LTATNRSRNAAGNIYYNEKCTGAVVGQQPFGGARGSGTNDKAGSISIFYRFVSARSIKENFVG 535 common mushroom
Q9P8I0       499 AVANDVLRNAAGNFYINCKSTGAVVGQQPFGGARASGTNDKAGSGNLLSRFVSLRSIKEEFVP 561 Emericella nidulans
XP_001208681 501 RQAQTALKHAAGMLYINTKCTGAVVGQHPFGGSRDSGTNDKTGTMAHLQRFVSVQTIKEEFTE 563 Aspergillus terreus NIH2624
NP_493946    491 YRARDVLRDAVGNMYLNDKSTGSIVGQQPFGGSRLSGTNDKAGGPHYGLRWTSPLTIKETSVS 553 nematode
XP_001632461 481 EEARDALRESCGNFYVNDKCTGSVVAQQPFGGARMSGTNDKAGGPMYLGRWVSPLSVKEAYEP 543 starlet sea anemone
XP_001391583 505 REAEDTLRYSAGNFYINCKTTAALIGQQSFGGSRSSGTNDKAGSANVLMRFASPRTIKEEFFP 567 Aspergillus niger CBS 513.88
XP_639145    482 ETAHKYLKNAAGNFYINDKCTGAVVGQQPFGGSRASGTNDKAGSSLNLLRWISARTIKENFVP 544 Dictyostelium discoideum AX4
XP_001744962 618 DTSLRVLHHAAGNIYINAKSTGSVVGQQPFGGARRSGTNDKAGAANYLLRFTSIQSAKECLYR 680 Monosiga brevicollis MX1

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap