Conserved Protein Domain Family
ALDH_PADH_NahF

?
cd07113: ALDH_PADH_NahF 
Escherichia coli NAD+-dependent phenylacetaldehyde dehydrogenase PadA-like
NAD+-dependent, homodimeric, phenylacetaldehyde dehydrogenase (PADH, EC=1.2.1.39) PadA of Escherichia coli involved in the catabolism of 2-phenylethylamine, and other related sequences, are present in this CD. Also included is the Pseudomonas fluorescens ST StyD PADH involved in styrene catabolism, the Sphingomonas sp. LB126 FldD protein involved in fluorene degradation, and the Novosphingobium aromaticivorans NahF salicylaldehyde dehydrogenase involved in the NAD+-dependent conversion of salicylaldehyde to salicylate.
Statistics
?
PSSM-Id: 143431
View PSSM: cd07113
Aligned: 6 rows
Threshold Bit Score: 862.133
Threshold Setting Gi: 2506352
Created: 14-Dec-2008
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
Feature 1:catalytic residues [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                        
P80668        21 GLYIDGRPGPAQSEKrlaIFDPATGQEIASTADaneaDVDNAVMSAWRAFVSrrwagrLPAERERILLRFADLVEQHSEE 100 Escherichia col...
ABO12279      19 GHFIDGKLVAAELLDkvdIVNPSTEQVVAQISIgsqqDVESAVKSAEHAFQNawa-etTPYERGVKLNKLADLIEQHGEE 97  Acinetobacter b...
ZP_02905263   19 GHYIDGRAVAGRGERi-dVRDPATRAVIGSVAQatddDVEAAIASSHRAFRSewa-nrTPADRERILLRFADLIEAHGEE 96  Burkholderia am...
ZP_02360828   19 AHFVGGASRAGASDHriaITNPATEQTIAHVRNadaaDVDAAVAAAKAAFHGawr-dtSAGRRAEILNRLADLIEQHGEE 97  Burkholderia ok...
YP_001342862  19 GQFINGQTKASGDNTf-dIINPSTEAVIAKIHSattqEVDAAIESSYQVFKGawg-ktSPYIRGVVLNKLADLIEQNGEE 96  Marinomonas sp....
NP_462044     19 GQFIAGERQAGNGTNf-sVTNPATGKIIADVVSatpaQAEEAMQSARRAFDVwr--kmPTLQRGALLLKLADTLAAHREE 95  Salmonella typh...
Feature 1                                                                                 #      
P80668       101 LAQLETLEQGKsiaISRAFEVGCTLNWMRYTAGLTTKIaGKTLDlsiplpqgarYQAWTRKEPVGVVAGIVPWNFPLMIG 180 Escherichia col...
ABO12279      98 LAQLETLSTGKlinISRHLEVAQSVIFLRYFAGWATKInGQTMQpsipsmqgekYTAFTLRQPVGVVAGIVPWNFSLMIG 177 Acinetobacter b...
ZP_02905263   97 IAQIETAQSGKligLSRVIEVGWSARWLRYYAGWATKIaGETLApsfpgmngerYTSFTLREPLGVVFGIIPWNFPVMIP 176 Burkholderia am...
ZP_02360828   98 IAQLETLCSGKhihVSRAIEVAQSATFLRYYAGWATKInGETIApslpsragerYTALTFREPVGVVAGIVPWNFSVMIA 177 Burkholderia ok...
YP_001342862  97 IAQLETLCSGKsihLSRMFEVQQSAMFLRYFAGWSTKInGETMTpsfpsmqgeeYSAFTRREAIGVVAGILPWNFSVMIA 176 Marinomonas sp....
NP_462044     96 LAQLESVCSGKtimLSRGLELDQSVAFLRYFAGWAGKItGETLNvslpsmgeerYTAFTQRQPIGVVVGIVPWNFSIMIA 175 Salmonella typh...
Feature 1                                                                                        
P80668       181 MWKVMPALAAGCSIVIKPSEtTPLTMLRVAELASEAGIPDGVFNVVTGSGavcGAALTSHPhVAKISFTGSTATGKGIAR 260 Escherichia col...
ABO12279     178 VWKIGSALTTGCTIVLKPSEfASLSLLRLAELAIEAGIPAGVINVVTGKGe-tGQYLIESPlVKKVSFTGSVPTGIAIGK 256 Acinetobacter b...
ZP_02905263  177 VWKFGAALATGNTVLIKSSEfTPLTMLRIAELATEAGLPAGALNVINGTGq-vGAKVIGDPrVAKVSFTGSVPTGRIIGE 255 Burkholderia am...
ZP_02360828  178 IWKIASALVTGCTVVIKPSEfSPLTLLRLAELATEAGVPPGALNVVNGDGn-vGRMLIDHAdVAKVSFTGSVATGIRVGT 256 Burkholderia ok...
YP_001342862 177 CWKIGAALCTGCTIVLKPSEfTPLTILRIAELAKEAGVPDGVLNIVNGKGd-vGGQLIQHPkVRKVSFTGSVATGKKISA 255 Marinomonas sp....
NP_462044    176 IWKLAAALVCGCTIVIKPSEyTPLTLLRVAELAKEAGFPDGVINVVNGAGgeiAQQLIAHPdCAKVSFTGSVATGEKVRR 255 Salmonella typh...
Feature 1                    #                              #  #                                 
P80668       261 TAAd-hLTRVTLELGGKNPAIVLKDADPQWVIEGLMTGSFLNqGQVCAASSRIYIEaplFDTLVSGFEQAVKSLQVGPGM 339 Escherichia col...
ABO12279     257 LAMssdLTRVSLELGGKNAIAVLADANIDEILPTLLQATFVHqGQVCASPERFFVHrtkYDELVDKLSKALSQFKIGSAM 336 Acinetobacter b...
ZP_02905263  256 QAVnanLTRFTLELGGKNAAAFLADTPVDKILDGIVEAGFLHsGQVCASAERFFVHrskFDEVVEKMKARLDSFQPADPM 335 Burkholderia am...
ZP_02360828  257 QAIganLTRATLELGGKNAAGFLEDVDVDDAVSGLLTAGYTHqGQICASPERVYVHrskLDEVLEKVKTGLQAIRVGSPL 336 Burkholderia ok...
YP_001342862 256 AASa-dLTRCTLELGGKNTAAILKDADIDRVVGGLFQLGYIHqGQVCAAPERVYVHssrIDELTTKLAQKLSEAKIGSPL 334 Marinomonas sp....
NP_462044    256 SATs-sGKRVTLELGGKNAALFLNDLTAQAMVNGILEAGYLNqGQICAAAERFYLPqekLDTVMTLLRQRLSEIVPGSPL 334 Salmonella typh...
Feature 1                                                                                        
P80668       340 SPVAQINPLVSRAHCDKVCSFLDDaqaqQAELIRGSNGpageGYYVAPTLVVNpdakLRLTREEVFGPVVNLVRVAdGEE 419 Escherichia col...
ABO12279     337 DEGSMFGPLSNQPHFHKVKHYLDMak-aNNQIIAGGEAldqtGYFVQPTLISFkntdDPLFSEETFGPVVGVMPFEtDEE 415 Acinetobacter b...
ZP_02905263  336 DDAGMIGPVCNEPQFRKCVDAFDLaraeGDTIVTGGGAyardGFYVKPTIVLPrsleSASYRKEIFGPVGAFVPFDdEEE 415 Burkholderia am...
ZP_02360828  337 DESVAFGPLANKPHLDKILGYFDWar-eNGEVVFGGRRvdrpGYFVEPTAVLAkhrdDRLLHEETFGPVISFLPYDtDDE 415 Burkholderia ok...
YP_001342862 335 DESVYFGPLSNEPQFNKVCEYLEIah-kESRVLHGGKAisgkGFFVEPTIVQAssvdETLMQEETFGPIISFMPYEdEEE 413 Marinomonas sp....
NP_462044    335 DEKTVMGPLANQVQLEKVLRLIQRareeGDTIVYGGETlpgeGYFLQPTAVKVrsknSTLMHEETFGPVCSFIGYQnEKE 414 Salmonella typh...
Feature 1                                                                                        
P80668       420 ALQLANDTEYGLTASVWTQNLSQALEYSDRLQAGTVWVNSHTLIDANLPFGGMKQSGTGRDFGPDWLDGWCETKSVCVRY 499 Escherichia col...
ABO12279     416 LIQLMNQSRFGLTASIWTNDLSKALRLIPKIEAGTLWVNMHTFLDPSVPFGGVKASGIGREFSDAFIEDYTELKSVMIRY 495 Acinetobacter b...
ZP_02905263  416 LIAMINDTPFGLTASLWTNDLSKALRYVPRIEAGTVWVNMHTLVDPAVPFGGAKGSGVGREYGSSFIDAYTEPKAVTIRF 495 Burkholderia am...
ZP_02360828  416 LVSLFNDTPFGLTASLWTNNLSKALRLIPRIEAGTLWVNMHTFLDPAVPFGGVKSSGLGREFGSAFIHDYTELKSVMIRY 495 Burkholderia ok...
YP_001342862 414 LIDLINNTPFGLSSSIWTNNLSQAMRMIPKIESGTVWVNMHSILDPSVPFGGTKQSGVGREFGREFINDYTEVKSVIMCY 493 Marinomonas sp....
NP_462044    415 ALSHINDSPFGLAASVWSENISKALRYAEDIDAGMVWVNMHTFLDPAVPFGGMKGSGIGREFGSAFIDDYTELKSVMVRY 494 Salmonella typh...

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap