Conserved Protein Domain Family
ALDH_SGSD_AstD

?
cd07095: ALDH_SGSD_AstD 
N-succinylglutamate 5-semialdehyde dehydrogenase, AstD-like
N-succinylglutamate 5-semialdehyde dehydrogenase or succinylglutamic semialdehyde dehydrogenase (SGSD, E. coli AstD, EC=1.2.1.71) involved in L-arginine degradation via the arginine succinyltransferase (AST) pathway and catalyzes the NAD+-dependent reduction of succinylglutamate semialdehyde into succinylglutamate.
Statistics
?
PSSM-Id: 143414
View PSSM: cd07095
Aligned: 19 rows
Threshold Bit Score: 541.092
Threshold Setting Gi: 196230845
Created: 30-Oct-2008
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
Feature 1:catalytic residues [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                       
Q7ADE6       38 QVGQACRAARAAFPRWARlSFAERQAVVERFAGLLERNKGELTAIIARETGKPRWEAATELTAMINKIAISIKAYhvRTG 117 Escherichia coli...
Q5WVZ4       47 EIANACYVAHRALKSWANtSFEERARYTKAFVEQVEKNRDQLARLISLETGKPLWESQTEVSSVIGKVNLSIQAYqeRTW 126 Legionella pneum...
ZP_01308560  42 QVKQAVAAAKQAQTEWALlGREKRVEITQRFATLLKENQTELARTISDETGKPTWEALTEVTAMANKVAISITAQdtRAS 121 Oceanobacter sp....
Q9AAL5       27 SIDAACHSARAAFAEWAMtPLAERRAIALRFAETVRARREEIATLIARETGKPMWEALTEADSVAAKVAISIRAQdeRAG 106 Caulobacter cres...
Q1GV29       23 DVDAEVEIARRAWPEWAAkPVTFRTETLRRFADRVKAESEAFADLIARETGKPLWEARTEVESVANKVDISVKAYaeRTP 102 Sphingopyxis ala...
YP_163007    30 DVDQAVSRARSVLSGWAKtALEDRIVILERFAAIIREKADIFGSIIARETGKPFWEAKTEAQIVANKVDISILAYkdRSY 109 Zymomonas mobili...
B0T8I8       40 EVAAAVEAARKAFPAWADrSREERIAVLRRYKDVLVARTGTFAEALSRETGKALWETKAELGSMAGKVEASIKAYdeRTG 119 Caulobacter sp. K31
ZP_00952157  40 IVKEAFGSSRAAFGEWALtPYEERRAVVEAYGDIVKAEADHIAQLISRETGKPLWETKGEAGAMAAKVGVSIAAHdeRAG 119 Oceanicaulis ale...
YP_760695    40 DVKAAVASAQAAFSGWARtPVAERISILERYAEELGKRAGEIAEAISRDMGKALWDSQAEAATMKAKIAVSVAALkeRAG 119 Hyphomonas neptu...
ZP_01093917  37 DVDDAFLAAVEAQIPWSAlPWEERATSLRAFAGAVRANRDAMTQAISAEVGKPLWDAATEVDAVAAKIEVTINAQqrRRP 116 Blastopirellula ...
Feature 1                                    #                                                  
Q7ADE6      118 EQRSemp--dgAASLRHRPHGVLAVFGPYNFPGHLPNGHIVPALLAGNTIIFKPSElTPWSGEAVMRLWQqaGLPPGVLN 195 Escherichia coli...
Q5WVZ4      127 PKQTeta--eaNACLRFKPHGVVVVLGAFNFPAHLSNGHIVPALLAGNTVLYKPSEhTPAVAELIIQCWHdsGLPPGVIN 204 Legionella pneum...
ZP_01308560 122 TGNAytg-dnkNLHLTHRPHGVMAVYGPYNFPGHLPNGHIVPALLAGNTIVFKPSEeTPKTAEESIKIWQeaGLPKGVIN 200 Oceanobacter sp....
Q9AAL5      107 ERSEpma--daTARLAHRPHGVLAVIGPFNFPMHLANGHIVPALLAGNAVVFKPSEkTPACGQLMGELWRaaGLPDHVLT 184 Caulobacter cres...
Q1GV29      103 NRRIega-mglRSAVRHKPHGALAVLGPYNFPAHLPNGHIVPALIAGNSVVFKPSEkTPAVGAKLVELLHsaGVPQEVLR 181 Sphingopyxis ala...
YP_163007   110 PVALpdiapniKSGISYKPHGVLAVLGPFNFPAHLPNGHIVPALIAGNVIIFKPSEkTPASGEFLVQCYHeaGVPKEVVQ 189 Zymomonas mobili...
B0T8I8      120 EHANdma--fgRAVLRHRAHGVMAVLGPFNFPGHLPNGHIVPALLAGDTVVFKPSEeTPLAGQLLVEALEeaGVPAGVIN 197 Caulobacter sp. K31
ZP_00952157 120 RKVTete--fgEAVLDHKPLGVMFVLGPYNFPGHLPNGHIIPALLAGNTVVFKPSElTPAVGEFMVQCWEkaGLPAGVLN 197 Oceanicaulis ale...
YP_760695   120 ERDEpaa--fgQSRLTHRPHGVMAVFGPFNFPGHLPNGHIVPALLAGNTCVFKPSElAPSVARLMADAFEaaGLPPGCLN 197 Hyphomonas neptu...
ZP_01093917 117 EETLdln--grIGRTWYRPLGVVAVYGPFNFPAHIANGQIVPALLAGNSVLFKPSElTPQVAELTTKLWNeaGLPPGVFN 194 Blastopirellula ...
Feature 1                                                      #                              # 
Q7ADE6      196 LVQGGCetGQALSALedLDGLLFTGSANTGYQLHRQLSgqPEKILALEMGGNNPLIIDEVaDIDAAVHLTIQSAFVTaGQ 275 Escherichia coli...
Q5WVZ4      205 CLQGNAncGNTLLSQd-IQGVYFTGSYATGLRIHQQFCnrPEIILALEMGGNNPLVIDEVkDIDAAVYHTMLSTMITaGQ 283 Legionella pneum...
ZP_01308560 201 LVQGAKevGVALGQAe-IDGLLFTGSSTTGKILHKQFAgkPEVLLALEMGGNNPLIVNDNiNVNNTVNVILQSAFLSaGQ 279 Oceanobacter sp....
Q9AAL5      185 IVIGGGeaGEALVRHeaLDGVLFTGGVQAGRAIHRALAdaPHKILALELGGNAPLVVWDVaDIEAAAHLIVQSAYVTaGQ 264 Caulobacter cres...
Q1GV29      182 LVVGGPdtGKALAAHpgIDGLLFTGSARTGLALNRQFAgqPGKMLALEMGGNNPIVAWDTaDIRTAAILIVQSAFLSaGQ 261 Sphingopyxis ala...
YP_163007   190 LLIGGRteGEALSRHngIDGLLFTGSSQGGVALSRVFAenPGRILALEMGGNNPLVIWNSeDIESAAAIAVQSAYLSaGQ 269 Zymomonas mobili...
B0T8I8      198 LVQGGRevGQALIDQe-IDGLLFTGSAAAGAFFRRHFAdrPDVILALELGGNNPLVVWDAgDPEAVAALIVQSAFITtGQ 276 Caulobacter sp. K31
ZP_00952157 198 LVQGARetGAAALDDpeLDGVLFTGSWNTGSFIHKKFAgrTGVQLALEMGGNNPLVVWDAaDAEAAARIAVLSSYITaGQ 277 Oceanicaulis ale...
YP_760695   198 IVHGGRdtGAALIDQp-INGLLFTGSAATGVFFHKHFAgrPEVILALEMGGNNPLIVWEPaDVDAAADIAAQSAYLTtGQ 276 Hyphomonas neptu...
ZP_01093917 195 LLQGGAatGRLIAEHadLRGLFFTGSLTTGLKLRETLVhrPEVLLALELGGNNPLVVLEPdQNLSMLNQVIQSAFLTsGQ 274 Blastopirellula ...
Feature 1        #                                                                              
Q7ADE6      276 RCTCARRVLLKsgaqGDAFLARLVAVSQRLTPGNWDDep-qPFIGGLISEQAAQQVFTAWQQLeamGGRTLLAPRLLqa- 353 Escherichia coli...
Q5WVZ4      284 RCTCARRIIVPdsqtGDLFLERFAKACKLMRIGSFDSqp-ePFIGPVISHVQALKHLHAQKQLvemGGEIILPMSLLve- 361 Legionella pneum...
ZP_01308560 280 RCTCARRLIVIegsnTDKLLIALKEKAAQLIADHPDAdpepFMGPVINANTKQALLKAQQDLIa-kGGKALLEMTALde- 357 Oceanobacter sp....
Q9AAL5      265 RCTCARRLILPegarGDALLEALTMLMDRLVIGGPFQsp-aPFMGPVIDAHAAAQVLAAQDRMtadGGRPLRLAAVRea- 342 Caulobacter cres...
Q1GV29      262 RCSNARRLIVKds-lADALIAEVRELANRLIVDHPHAdp-aPYMGPVIDNEAADGLTESFLVLmsnGGQVIRHMTRPva- 338 Sphingopyxis ala...
YP_163007   270 RCTCARRLIVEdg-kHQPLLDAIQRLIGRLIIDQPFAdpqpFMGSVIDNAAADHAEKAYNDLVa-nGAKILHPLHRLeq- 346 Zymomonas mobili...
B0T8I8      277 RCSCARRLIVSddaaGRAVIDAVAALSERLVIGPWNGgq-ePFMGPLISDRAAAMALAGAKAM---PGQTLRAMTSVdgl 352 Caulobacter sp. K31
ZP_00952157 278 RCSCARRLILPqgaaGDAVVEQLVGMIGKLSVNVWNAdpepFMGPLVSAQAAANVLKAQDELIa-lGARPIVKSEAMal- 355 Oceanicaulis ale...
YP_760695   277 RCSCARRLILPngafGDKVLEAIIARAKGIEVGAWDEpg-iFMGPLVSHTAASQAVAFYEMLLs-kGAASLLPLEAGpq- 353 Hyphomonas neptu...
ZP_01093917 275 RCTCVRRLILVg--eSAAFLQQLQEKTSQIAVGAADAnpepFMGPLIHAAAAERILSQQQRLVa-gGAVPILESRRMps- 350 Blastopirellula ...
Feature 1                                                                                       
Q7ADE6      354 gTSLLTPGIIEMTgvaGVPDEEVFGPLLRVWRYDsFEEAIRMANNTRFGLSCGLVSPerEKFDQLLLeARAGIVNWNKPL 433 Escherichia coli...
Q5WVZ4      362 yTGLISPGIIDMTrakNPPDEEIFAPFAQIYRYNhFDEAIQLANQTRYGLSAGLLSDnkDHYLQFYQhIRAGLINWNRPT 441 Legionella pneum...
ZP_01308560 358 tSNLLTPAILDMTdakDVPDEEWFGPLLQVYRVNdFSMAMKLANDTQYGLSAGLISDdaTQQNQFLNtIRAGVVSINQPT 437 Oceanobacter sp....
Q9AAL5      343 rSALLSPGLIELTd-aPLRDEEIFGPLLQVRRAAdFDAALALANATRFGLAAGLISDdeALYRRFWTsVRAGIVNWNRPT 421 Caulobacter cres...
Q1GV29      339 gRPFLTPGIIDVTtmaERPDVELFGPLLQVIRVEtFEAAIAEANNTAFGLSAALIGGtpQLYDQFWAnARAGVINWNRPT 418 Sphingopyxis ala...
YP_163007   347 dKPFLTPALLDMTdcaDKVDEEIFAPVLKVIRVSdFEAAIKEANNTRFGLSAALVDDspEDFMRFRDeVRAGVINWNRPT 426 Zymomonas mobili...
B0T8I8      353 sRAFVSPGLVDVTg-eTVPDEELFAPLLQVRRVGsFEEAIAAANATRYGLSAGLVSNetAHWDRFLTrIRAGVVNWNRPT 431 Caulobacter sp. K31
ZP_00952157 356 gDAFVSPGLLDVDg-vDTPDEEVFGPLLQVRRADsFEAALKEANNTAYGLSAGLVSDseDLWKQFWAgSRAGIVNRNRPT 434 Oceanicaulis ale...
YP_760695   354 gTGFVSPGVVDVTearDVPDEELFGPLIQIVRVAsFDEAIARANASRYGLSGGLVSDddALWARAYSeMRAGILNRNRPT 433 Hyphomonas neptu...
ZP_01093917 351 gPAFLSPGLIDVTtcgSRSDEEMFGPLLQVIRVDdFSAAIREANQTRFGLVAGLLGGghDDFQRFRRqVNAGLVNWNLPT 430 Blastopirellula ...
Feature 1                                           
Q7ADE6      434 TGAASTAPFGGIGASGNHRPSAWYAADYCAWPMASL 469 Escherichia coli O157:H7 str. EC508
Q5WVZ4      442 TGAASSLPFGGVGCSGNHRPSAYFAADYCAYPVASM 477 Legionella pneumophila str. Lens
ZP_01308560 438 AGASSELPFGGVGLSGNHRASALYAADYCAWPQSLM 473 Oceanobacter sp. RED65
Q9AAL5      422 TGASSAAPFGGVGGSGNHRPSAYYAADYSAYPVAGL 457 Caulobacter crescentus CB15
Q1GV29      419 NGASSAAPFGGVGLSGNHRPSAFYAADYCAYPVASA 454 Sphingopyxis alaskensis RB2256
YP_163007   427 NGAPSTAPFGGVGLSGNHRPSAYFAADYCAYPVTST 462 Zymomonas mobilis subsp. mobilis ZM4
B0T8I8      432 TGAAGTMPFGGLGNSGNHRPSAYYAADYCAYPVASF 467 Caulobacter sp. K31
ZP_00952157 435 PGAASTMPFGGPGQSGNLRPSAYYAADYVAYPVATQ 470 Oceanicaulis alexandrii HTCC2633
YP_760695   434 AGASGAMPFGGPGLSGNFRPGAYYAADYCAWPQASQ 469 Hyphomonas neptunium ATCC 15444
ZP_01093917 431 TGASGRLPFGGMGQSGNYRPAGYFATDFCNIPVAGL 466 Blastopirellula marina DSM 3645

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap