2BJA,2BHQ


Conserved Protein Domain Family
ALDH_P5CDH

?
cd07083: ALDH_P5CDH 
Click on image for an interactive view with Cn3D
ALDH subfamily NAD+-dependent delta(1)-pyrroline-5-carboxylate dehydrogenase-like
ALDH subfamily of the NAD+-dependent, delta(1)-pyrroline-5-carboxylate dehydrogenases (P5CDH, EC=1.5.1.12). The proline catabolic enzymes, proline dehydrogenase and P5CDH catalyze the two-step oxidation of proline to glutamate. P5CDH catalyzes the oxidation of glutamate semialdehyde, utilizing NAD+ as the electron acceptor. In some bacteria, the two enzymes are fused into the bifunctional flavoenzyme, proline utilization A (PutA). These enzymes play important roles in cellular redox control, superoxide generation, and apoptosis. In certain prokaryotes such as Escherichia coli, PutA is also a transcriptional repressor of the proline utilization genes. Monofunctional enzyme sequences such as those seen in the Bacillus RocA P5CDH are also present in this subfamily as well as the human ALDH4A1 P5CDH and the Drosophila Aldh17 P5CDH.
Statistics
?
PSSM-Id: 143402
View PSSM: cd07083
Aligned: 4 rows
Threshold Bit Score: 780.608
Threshold Setting Gi: 93278855
Created: 14-Jan-2009
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 9 residues -Click on image for an interactive view with Cn3D
Feature 1:NAD binding site [chemical binding site]
Evidence:
  • Structure:2BJA: Thermus thermophilus 1-Pyrroline-5-Carboxylate Dehydrogenase with bound NADH; defined using 3.5 A.
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                      
2BJA_A      20 RRAMREALRRVReefGRHYPLYIGgewvdtkERMVSLNPsapsEVVGTTAKagkaEAEAALEAAWKAFKTWKdwPQEDRS 99   Thermus thermoph...
NP_719311  548 AEPFFAALDKFKstqWQAGPLVNGqpl--tgEHKTIVSPfdttQTVGQVAFadkaAIEQAVSSAHAAFGSWTrtPVEVRA 625  Shewanella oneid...
2BHQ_A      20 RRAMREALRRVReefGRHYPLYIGgewvdtkERMVSLNPsapsEVVGTTAKagkaEAEAALEAAWKAFKTWKdwPQEDRS 99   Thermus thermoph...
P30038      47 RDALQKALKDLKg-rMEAIPCVVGdeevwtsDVQYQVSPfnhgHKVAKFCYadksLLNKAIEAALAARKEWDlkPIADRA 125  human
Feature 1                                                                                      
2BJA_A     100 RLLLKAAALMRRRKRELEATLVYEV-GKNWVE-ASADVAEAIDFIEYYARAALRyrypavevvpypgedNESFYVPL-GA 176  Thermus thermoph...
NP_719311  626 SALQKLADLLEENREELIALCTREA-GKSIQD-GIDEVREAVDFCRYYAVQAKKlmskpellpgptgelNELFLQGR-GV 702  Shewanella oneid...
2BHQ_A     100 RLLLKAAALMRRRKRELEATLVYEV-GKNWVE-ASADVAEAIDFIEYYARAALRyrypavevvpypgedNESFYVPL-GA 176  Thermus thermoph...
P30038     126 QIFLKAADMLSGPRRAEILAKTMVGqGKTVIQaEIDAAAELIDFFRFNAKYAVElegqqpi--svppstNSTVYRGLeGF 203  human
Feature 1         ##                         # ##                             #                
2BJA_A     177 GVVIAPWNFPvAIFTGMIVGPVAVGNTVIAKPAEdaVVVGAKVFEIFHEaGFPPGVVNFLPGVGEevGAYLVEHPriRFI 256  Thermus thermoph...
NP_719311  703 FVCISPWNFPlAIFLGQVSAALAAGNTVVAKPAEqtSIIGYRAVQLAHQaGIPTDVLQYLPGTGAtvGNALTADEriGGV 782  Shewanella oneid...
2BHQ_A     177 GVVIAPWNFPvAIFTGMIVGPVAVGNTVIAKPAEdaVVVGAKVFEIFHEaGFPPGVVNFLPGVGEevGAYLVEHPriRFI 256  Thermus thermoph...
P30038     204 VAAISPFNFT-AIGGNLAGAPALMGNVVLWKPSDtaMLASYAVYRILREaGLPPNIIQFVPADGPlfGDTVTSSEhlCGI 282  human
Feature 1       #  #  #                                                                        
2BJA_A     257 NFTGSLEVGLKIYEAAGrlapgqtwFKRAYVETGGKDAIIVDETaDFDLAAEGVVVSAYGFqGQKXSAASRLILTqgaYE 336  Thermus thermoph...
NP_719311  783 CFTGSTGTAKLINRTLAnre---gaIIPLIAETGGQNAMVVDSTsQPEQVVNDVVSSSFTSaGQRCSALRVLFLQediAD 859  Shewanella oneid...
2BHQ_A     257 NFTGSLEVGLKIYEAAGrlapgqtwFKRAYVETGGKDAIIVDETaDFDLAAEGVVVSAYGFqGQKCSAASRLILTqgaYE 336  Thermus thermoph...
P30038     283 NFTGSVPTFKHLWKQVAqnldrfhtFPRLAGECGGKNFHFVHRSaDVESVVSGTLRSAFEYgGQKCSACSRLYVPhslWP 362  human
Feature 1                                                                                      
2BJA_A     337 PVLERVLKRAERLsVGPAEEn--PDLGPVVSAEQERKVLSYIEIGKn--eGQLVLGGKRLeg--eGYFIAPTVFTEVppk 410  Thermus thermoph...
NP_719311  860 RVIDVLQGAMDELvIGNPSSi-kTDVGPVIDATAKANLDAHIDHIKq--vGKLIKQMSLPagtenGHFVAPTAVEIDs-- 934  Shewanella oneid...
2BHQ_A     337 PVLERVLKRAERLsVGPAEEn--PDLGPVVSAEQERKVLSYIEIGKn--eGQLVLGGKRLeg--eGYFIAPTVFTEVppk 410  Thermus thermoph...
P30038     363 QIKGRLLEEHSRIkVGDPAEdfgTFFSAVIDAKSFARIKKWLEHARsspsLTILAGGKCDds--vGYFVEPCIVESKdpq 440  human
Feature 1                                                                                      
2BJA_A     411 ARIAQEEIFGPVLSVIRVk--DFAEALEVANDTpyGLTGGVYSRk-REHLEWARREF--HVGNLYFNRKiTGALVGVQPF 485  Thermus thermoph...
NP_719311  935 IKVLEKEHFGPILHVIRYkasELAHVIDEINSTgfGLTLGIHSRn-EGHALEVADKV--NVGNVYINRNqIGAVVGVQPF 1011 Shewanella oneid...
2BHQ_A     411 ARIAQEEIFGPVLSVIRVk--DFAEALEVANDTpyGLTGGVYSRk-REHLEWARREF--HVGNLYFNRKiTGALVGVQPF 485  Thermus thermoph...
P30038     441 EPIMKEEIFGPVLSVYVYpddKYKETLQLVDSTtsYGLTGAVFSqdKDVVQEATKVLrnAAGNFYINDKsTGSIVGQQPF 520  human
Feature 1                                     
2BJA_A     486 GGFKLSGTNAKTGALDYLRLFLEMKAVAERF 516  Thermus thermophilus
NP_719311 1012 GGQGLSGTGPKAGGPHYLTRFVTEKTRTNNI 1042 Shewanella oneidensis MR-1
2BHQ_A     486 GGFKLSGTNAKTGALDYLRLFLEMKAVAERF 516  Thermus thermophilus
P30038     521 GGARASGTNDKPGGPHYILRWTSPQVIKETH 551  human

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap