1NHZ,3CLD,1M2Z,3BQD


Conserved Protein Domain Family
NR_LBD_GR

?
cd07076: NR_LBD_GR 
Click on image for an interactive view with Cn3D
Ligand binding domain of the glucocorticoid receptor, a member of the nuclear receptor superfamily
The ligand binding domain of the glucocorticoid receptor (GR): GR is a ligand-activated transcription factor belonging to the nuclear receptor superfamily. It binds with high affinity to cortisol and other glucocorticoids. GR is expressed in almost every cell in the body and regulates genes controlling a wide variety of processes including the development, metabolism, and immune response of the organism. In the absence of hormone, the glucocorticoid receptor (GR) is complexes with a variety of heat shock proteins in the cytosol. The binding of the glucocorticoids results in release of the heat shock proteins and transforms it to its active state. One mechanism of action of GR is by direct activation of gene transcription. The activated form of GR forms dimers, translocates into the nucleus, and binds to specific hormone responsive elements, activating gene transcription. GR can also function as a repressor of other gene transcription activators, such as NF-kappaB and AF-1 by directly binding to them, and bloc king the expression of their activated genes. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, GR has a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD). The LBD also functions for dimerization and chaperone protein association.
Statistics
?
PSSM-Id: 132761
View PSSM: cd07076
Aligned: 7 rows
Threshold Bit Score: 500.615
Threshold Setting Gi: 82253198
Created: 16-Dec-2008
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 18 residues -Click on image for an interactive view with Cn3D
Feature 1:ligand binding site [chemical binding site]
Evidence:
  • Structure:1NHZ_a; human Glucocorticoid receptor binds to antagonist RU-486, contacts at 4A
    View structure with Cn3D
  • Structure:3CLD_a; human glucocoticoid receptor binds to agonist fluticasone furoate, contacts at 4A
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                     #  ##  #  ##                            ##  ##  #  
1NHZ_A        34 TLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMSLMAFALGW 113 human
NP_001032915 526 TLVSLLEVIEPEVLYSGYDSTLPDSSWRIMSTLNMLGGRQVVAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGW 605 chicken
P49844       530 TLISLLEVIEPEVLYSGYDSSIPDTTRRLMSSLNMLGGRQVVSAVRWAKAIPGFRNLHLDDQMTLLQYSWMFLMVFALGW 609 African clawed ...
Q4RIR9       110 TMLSVLKAIEPETIYSGYDSTLPDTSSRLMSTLNRLGGQQVVSAVKWAKSLPGFRNLHLDDQMILLQCSWLFLMSFSLGW 189 Tetraodon nigro...
3CLD_A        13 TLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMYLMAFALGW 92  human
1M2Z_A        11 TLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMSLMAFALGW 90  human
3BQD_A         9 TLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMSLMAFALGW 88  human
Feature 1        #           #                  #   #                                            
1NHZ_A       114 RSYRQSSANLLCFAPDLIINEQRMTLPDMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIR 193 human
NP_001032915 606 RSYKQSNGNLLCFAPDLIINEQRMNLPCMYEQCKHMLMVARELSRLQVSYEEYLCMKTLLLLSTIPKEGLKSQTLFEEIR 685 chicken
P49844       610 RSYKQTNGSILYFAPDLVITEDRMHLPFMQERCQEMLKIAGEMSSLQISYDEYLCMKVLLLMCTIPKEGLKSHALFEEIR 689 African clawed ...
Q4RIR9       190 RSYQQCNGSMLCFAPDLVINEERMRLPFMNDQCEKMLRICREFVRLQLSHEEYLCMKVLLLLSTVPKDGLKSQAVFDEIR 269 Tetraodon nigro...
3CLD_A        93 RSYRQSSANLLCFAPDLIINEQRMTLPGMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIR 172 human
1M2Z_A        91 RSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIR 170 human
3BQD_A        89 RSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIR 168 human
Feature 1                                                 #  # #                                 
1NHZ_A       194 MTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIK 273 human
NP_001032915 686 MTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHDVVENLLSFCFQTFLDKSMSIEFPEMLAEIISNQIPKYSNGNIK 765 chicken
P49844       690 MTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHEVAENLLAFCFLSFLDKSMSIEFPDMLSEIISNQIPKYSSGNLK 769 African clawed ...
Q4RIR9       270 MTYIKELGKAIVKREENPSQNWQRFYQLTKLLDSMQEMVEGLIKFCFYTFVNKTLSVEFPEMLVEIITNQIPKFQEGGIK 349 Tetraodon nigro...
3CLD_A       173 MTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIK 252 human
1M2Z_A       171 MTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIK 250 human
3BQD_A       169 MTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIK 248 human
Feature 1               
1NHZ_A       274 KLLFHQK 280 human
NP_001032915 766 KLLFHQK 772 chicken
P49844       770 KLLFHQK 776 African clawed frog
Q4RIR9       350 ALLFHQK 356 Tetraodon nigroviridis
3CLD_A       253 KLLFHQK 259 human
1M2Z_A       251 KLLFHQK 257 human
3BQD_A       249 KLLFHQK 255 human

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap