2AA6,2AA2,2A3I,2OAX,1Y9R,2ABI


Conserved Protein Domain Family
NR_LBD_MR

?
cd07075: NR_LBD_MR 
Click on image for an interactive view with Cn3D
Ligand binding domain of the mineralocorticoid receptor, a member of the nuclear receptor superfamily
The ligand binding domain of the mineralocorticoid receptor (MR): MR, also called aldosterone receptor, is a member of nuclear receptor superfamily involved in the regulation of electrolyte and fluid balance. The receptor is activated by mineralocorticoids such as aldosterone and deoxycorticosterone as well as glucocorticoids, like cortisol and cortisone. Binding of its ligand results in its translocation to the cell nucleus, homodimerization and binding to hormone response elements (HREs) present in the promoter of MR controlled genes. This results in the recruitment of the coactivators and the transcription of the activated genes. MR is expressed in many tissues and its activation results in the expression of proteins regulating electrolyte and fluid balance. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, MR has a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD ). The LBD, in addition to binding ligand, contains a ligand-dependent activation function-2 (AF-2).
Statistics
?
PSSM-Id: 132760
View PSSM: cd07075
Aligned: 10 rows
Threshold Bit Score: 501.393
Threshold Setting Gi: 47217367
Created: 16-Dec-2008
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
ligand bindinghomodimercoactivator
Conserved site includes 15 residues -Click on image for an interactive view with Cn3D
Feature 1:ligand binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                        ## ##  #                              #  #   #  
2AA6_A        28 SPVMVLENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQMIQVVKWAKVLPGFKNLPLEDQITLIQYSWMSLLSFALSW 107  human
NP_001070158 734 SPVKILESIEPEIVYAGYDSSKPDTAEYLLSTLNRLAGKQMIQVVKWAKILPGFRNLPLEDQITLIQYSWMCLSSFALSW 813  zebra finch
2AA2_A        28 SPVMVLENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQMIQVVKWAKVLPGFKNLPLEDQITLIQYSWMSLSSFALSW 107  human
2A3I_A         6 SPVMVLENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQMIQVVKWAKVLPGFKNLPLEDQITLIQYSWMSLSSFALSW 85   human
2OAX_A         9 SPVMVLENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQMIQVVKWAKVLPGFKNLPLEDQITLIQYSWMCLLSFALSW 88   human
1Y9R_A         8 SPVMVLENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQMIQVVKWAKVLPGFKNLPLEDQITLIQYSWMCLLSFALSW 87   human
2ABI_A         9 SPVMVLENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQMIQVVKWAKVLPGFKNLPLEDQITLIQYSWMCLSSFALSW 88   human
Q91573       365 SAAVILENIEPEIVYAGYDNTQPDTAENLLSSLNQLAGKQMVQVVKWAKVIPGFRNLPLEDQITLIQYSWMCLSSFALSW 444  African clawed...
Q9IAC6       112 SICSVLELIEPEVVFAGYDNTQPDTTDHLLSSLNQLAGKQMIRVVKWAKVLPGFRGLPIEDQITLIQYSWMCLSSFSLSW 191  rainbow trout
CAG11072     173 SICSILELIEPEEVYSGYDNTQPDTTDHLLSSLNRLAGKQMVRMVKWAKVLPGFRGLPIEDQITLIQYSWMCLSSFCLSW 252  spotted green ...
Feature 1        #           #               #      #                                            
2AA6_A       108 RSYKHTNSQFLYFAPDLVFNEEKMHQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKS-------- 179  human
NP_001070158 814 RSYKHTNSQFLYFAPDLIFDEERMRQSAMFELCQGMHQISLQFVRLQLSFEEYTIMKVLLLLSTVPKDGLKS-------- 885  zebra finch
2AA2_A       108 RSYKHTNSQFLYFAPDLVFNEEKMHQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKS-------- 179  human
2A3I_A        86 RSYKHTNSQFLYFAPDLVFNEEKMHQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKS-------- 157  human
2OAX_A        89 RSYKHTNSQFLYFAPDLVFNEEKMHQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKS-------- 160  human
1Y9R_A        88 RSYKHTNSQFLYFAPDLVFNEEKMHQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKS-------- 159  human
2ABI_A        89 RSYKHTNSQFLYFAPDLVFNEEKMHQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKS-------- 160  human
Q91573       445 RSYKHASSQFLYFAPDLIFNEERMRQSAMYDLCQGMQQISLEFSRLQLTFEEYTLMKVLLLLSTVPKDGLKC-------- 516  African clawed...
Q9IAC6       192 RSYKHTNGQMLYFAPDLVFNEDRMQQSAMYDLCLGMRQVSQEFVRLQLTYQEFLSMKVLLLLSTVPKEGLKN-------- 263  rainbow trout
CAG11072     253 RSYKHTNGQMLYFAPDLIFNEERMRQSAMYDLCLGMRQVSQEFLRLQLSYDEFLSMKVLLLLSTGLGRLTLFgfhcskql 332  spotted green ...
Feature 1                                                                             ##  #      
2AA6_A       180 -----------------QAAFEEMRTNYIKELRKMVTKCPNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRES-- 240  human
NP_001070158 886 -----------------QAAFEEMRANYIKELKKMVTKCPSNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRES-- 946  zebra finch
2AA2_A       180 -----------------QAAFEEMRTNYIKELRKMVTKCPNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRES-- 240  human
2A3I_A       158 -----------------QAAFEEMRTNYIKELRKMVTKCPNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRES-- 218  human
2OAX_A       161 -----------------QAAFEEMRTNYIKELRKMVTKAPNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRES-- 221  human
1Y9R_A       160 -----------------QAAFEEMRTNYIKELRKMVTKAPNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRES-- 220  human
2ABI_A       161 -----------------QAAFEEMRTNYIKELRKMVTKAPNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRES-- 221  human
Q91573       517 -----------------QAAFEEMRVNYIKELRKVLLKSPHNSGQSWQRYFQLTKLLDSMQDLVGDLLEFCFYTFRES-- 577  African clawed...
Q9IAC6       264 -----------------QAAFEEMRVNYIKELRRSVGKAPTTLDRRGNRSSQLTKLLDAMHDLGGELLDFCFYTFRES-- 324  rainbow trout
CAG11072     333 ppspphmrtvpkeglknQAAFEEMRLNYIKELRRSVGKATNNSGQTWQRFFQLTKLLDAMHDVSTLCLPRHAAPLGRPhd 412  spotted green ...
Feature 1                                                                                        
2AA6_A       241 ------------------------------------------------------HALKVEFPAMLVEIISDQLPKVESGN 266  human
NP_001070158 947 ------------------------------------------------------QALKVEFPAMLVEIISDQLPKVESGN 972  zebra finch
2AA2_A       241 ------------------------------------------------------HALKVEFPAMLVEIISDQLPKVESGN 266  human
2A3I_A       219 ------------------------------------------------------HALKVEFPAMLVEIISDQLPKVESGN 244  human
2OAX_A       222 ------------------------------------------------------HALKVEFPAMLVEIISDQLPKVESGN 247  human
1Y9R_A       221 ------------------------------------------------------HALKVEFPAMLVEIISDQLPKVESGN 246  human
2ABI_A       222 ------------------------------------------------------HALKVEFPAMLVEIISDQLPKVESGN 247  human
Q91573       578 ------------------------------------------------------QALKVEFPAMLVEIISDQLPKVESGI 603  African clawed...
Q9IAC6       325 ------------------------------------------------------QALKVEFPEMLVEIISDQIPKVESGN 350  rainbow trout
CAG11072     413 ttgfppsfqesphlhtqskkaaqtpcetaskymceysklvgnlldfcfytfresQVLKVEFPEMLVEIISDQIPKVESGL 492  spotted green ...
Feature 1                 
2AA6_A       267 AKPLYFHRK 275  human
NP_001070158 973 AKPLYFHRK 981  zebra finch
2AA2_A       267 AKPLYFHRK 275  human
2A3I_A       245 AKPLYFHRK 253  human
2OAX_A       248 AKPLYFHRK 256  human
1Y9R_A       247 AKPLYFHRK 255  human
2ABI_A       248 AKPLYFHRK 256  human
Q91573       604 AKPLYFHRK 612  African clawed frog
Q9IAC6       351 THTLYFHKK 359  rainbow trout
CAG11072     493 THTIYFHKK 501  spotted green pufferfish

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap