1SR7,1SQN,1E3K,1A28


Conserved Protein Domain Family
NR_LBD_PR

?
cd07074: NR_LBD_PR 
Click on image for an interactive view with Cn3D
Ligand binding domain of the progesterone receptor, a member of the nuclear hormone receptor
The ligand binding domain of the progesterone receptor (PR): PR is a member of the nuclear receptor superfamily of ligand dependent transcription factors, mediating the biological actions of progesterone. PR functions in a variety of biological processes including development of the mammary gland, regulating cell cycle progression, protein processing, and metabolism. When no binding hormone is present the carboxyl terminal inhibits transcription. Binding to a hormone induces a structural change that removes the inhibitory action. After progesterone binds to the receptor, PR forms a dimer and the complex enters the nucleus where it interacts with the hormone response element (HRE) in the promoters of progesterone responsive genes and alters their transcription. In addition, rapid actions of PR that occur independent of transcription, have also been observed in several tissues like brain, liver, mammary gland and spermatozoa. There are two natural PR isoforms called PR-A and PR-B. PR-B has an additional stretc h of 164 amino acids at the N terminus. The extra domain in PR-B performs activation functions by recruiting coactivators that could not be recruited by PR-A. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, PR has a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD). The LBD is not only involved in binding to progesterone, but also involved in coactivator binding and dimerization.
Statistics
?
PSSM-Id: 132759
View PSSM: cd07074
Aligned: 7 rows
Threshold Bit Score: 492.149
Threshold Setting Gi: 3402177
Created: 16-Dec-2008
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 22 residues -Click on image for an interactive view with Cn3D
Feature 1:ligand binding site [chemical binding site]
Evidence:
  • Structure:1SR7_a; human progesterone receptor binds to mometasone furoate, contacts at 4A.
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                  #  ## ##  #                              #  ##     
1SR7_A     12 PLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGW 91  human
P07812    539 PMISVLRGIEPEVVYAGYDNTKPETPSSLLTSLNHLCERQLLCVVKWSKLLPGFRNLHIDDQITLIQYSWMSLMVFAMGW 618 chicken
Q8UVY3    456 ELLQILQSIEPEVVYAGYDNTQPETPSALLSSLNQLCERQLVCVVKWSKSLPGFRNLHIDDQITLLQYSWMSLMVFALGW 535 African clawed frog
CAQ14518  306 QMISILENIEPQVVYSGYDNTQPEVPHLLLNSLNRLCERQLLWIVRWSKSLPGFRNLHINDQMTLIQYSWMGLMLFSLGW 385 zebrafish
1SQN_A     14 PLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGW 93  human
1E3K_A     11 PLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGW 90  human
1A28_A      9 PLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGW 88  human
Feature 1     #           #               #  ##  #                                            
1SR7_A     92 RSYKHVSGQMLYFAPDLILNEQRMKESSFYSLCLTMWQIPQEFvKLQVSQEEFLCMKVLLLLNTIPLEGLRSQTQFEEMR 171 human
P07812    619 RSYKHVSGQMLYFAPDLILNEQRMKESSFYSLCLSMWQLPQEFvRLQVSQEEFLCMKALLLLNTIPLEGLRSQSQFDEMR 698 chicken
Q8UVY3    536 RSYQHVSGQMLYFAPDLILNEQRMKDSSFYTLCLSMWQLPQEFmKLQVTHEEFLCMKALLLLNTIPLEGLKSQTNFDEMR 615 African clawed frog
CAQ14518  386 RTFQNVTPDYLYFAPDLVLSNDQLRRSPIYDLCLAMQFVPQEFaNLQVTKEEFLCMKALMLLNTVPLEGLKSQTQFDEMR 465 zebrafish
1SQN_A     94 RSYKHVSGQMLYFAPDLILNEQRMKESSFYSLCLTMWQIPQEFvKLQVSQEEFLCMKVLLLLNTIPLEGLRSQTQFEEMR 173 human
1E3K_A     91 RSYKHVSGQMLYFAPDLILNEQRMKESSFYSLCLTMWQIPQEFvKLQVSQEEFLCMKVLLLLNTIPLEGLRSQTQFEEMR 170 human
1A28_A     89 RSYKHVSGQMLYFAPDLILNEQRMKESSFYSLCLTMWQIPQEFvKLQVSQEEFLCMKVLLLLNTIPLEGLRSQTQFEEMR 168 human
Feature 1                                              #  ##  #        # #   #                
1SR7_A    172 SSYIRELIKAIGLRQKGVVSsSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIAAQLPKILAGMV 251 human
P07812    699 TSYIRELVKAIGLRQKGVVAnSQRFYQLTKLMDSMHDLVKQLHLFCLNTFLQSRALSVEFPEMMSEVIAAQLPKILAGMV 778 chicken
Q8UVY3    616 SNYIRELAKAISLRHKGVIAsSQRFYQLTKLMDSMHELVKQLHLYCLNTFLQSRSLSVEFPEMMSEVISAQLPKILAGMV 695 African clawed frog
CAQ14518  466 QNYICELSKAIQLKEKGVVAsSQRFYHLTKLMDNMHEIVKKVNLYCLSTFIQADAMKVEFPEMMTEVIASQLPKVLAGMV 545 zebrafish
1SQN_A    174 SSYIRELIKAIGLRQKGVVSsSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIAAQLPKILAGMV 253 human
1E3K_A    171 SSYIRELIKAIGLRQKGVVSsSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIAAQLPKILAGMV 250 human
1A28_A    169 SSYIRELIKAIGLRQKGVVSsSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIAAQLPKILAGMV 248 human
Feature 1             
1SR7_A    252 KPLLFHKK 259 human
P07812    779 KPLLFHKK 786 chicken
Q8UVY3    696 KPLVFHKK 703 African clawed frog
CAQ14518  546 KPLMFHHK 553 zebrafish
1SQN_A    254 KPLLFHKK 261 human
1E3K_A    251 KPLLFHKK 258 human
1A28_A    249 KPLLFHKK 256 human

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap