2AX9,1XJ7,1T73,1T5Z,1XOW,2Q7K


Conserved Protein Domain Family
NR_LBD_AR

?
cd07073: NR_LBD_AR 
Click on image for an interactive view with Cn3D
Ligand binding domain of the nuclear receptor androgen receptor, ligand activated transcription regulator
The ligand binding domain of the androgen receptor (AR): AR is a member of the nuclear receptor family. It is activated by binding either of the androgenic hormones, testosterone or dihydrotestosterone, which are responsible for male primary sexual characteristics and for secondary male characteristics, respectively. The primary mechanism of action of ARs is by direct regulation of gene transcription. The binding of an androgen results in a conformational change in the androgen receptor which causes its transport from the cytosol into the cell nucleus, and dimerization. The receptor dimer binds to a hormone response element of AR-regulated genes and modulates their expression. Another mode of action is independent of their interactions with DNA. The receptors interact directly with signal transduction proteins in the cytoplasm, causing rapid changes in cell function, such as ion transport. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, AR has a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD). The LBD is not only involved in binding to androgen, but also involved in binding of coactivator proteins and dimerization. A ligand dependent nuclear export signal is also present at the ligand binding domain.
Statistics
?
PSSM-Id: 132758
View PSSM: cd07073
Aligned: 9 rows
Threshold Bit Score: 486.753
Threshold Setting Gi: 82225292
Created: 16-Dec-2008
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
ligand bindingcoactivator
Conserved site includes 17 residues -Click on image for an interactive view with Cn3D
Feature 1:ligand binding site [chemical binding site]
Evidence:
  • Structure:2AX9_a; human androgen receptor binds to Nonsteroidal Agonist R-3, contacts at 4A
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                  #  ## ##  #                             ##  ##  #  
2AX9_A      9 IFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGW 88  human
Q7T1K4    530 IFLNVLEAIEPMVVCSGHDNNQPDSFALLLSSLNELGERQLVHVVKWAKALPGFRNLHVNDQMTVIQYSWMGLMIFAMGW 609 bullfrog
Q8JH77     86 IFLNVLEAIEPGVVCAGHDNSQPDSFSNLLSSLNELGERQLVYVVKWAKALPGFRNLHVDDQMSIIQYSWMGLMVFAMGW 165 Taeniopygia guttata
Q9YGV9    602 MFLNILEAIEPEVVNAGHDYGQPDSAASLLTSLNELGERQLVKVVKWAKGMPGFRSLYVDDQMTVIQHSWMAVMVFALGW 681 Japanese eel
1XJ7_A     10 IFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGW 89  human
1T73_A     22 IFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGW 101 chimpanzee
1T5Z_A      4 IFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGW 83  human
1XOW_A      2 IFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGW 81  human
2Q7K_A     10 IFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGW 89  human
Feature 1     #           #               #      #                                            
2AX9_A     89 RSFTNVNSRMLYFAPDLVFNEYRMHKSRMYsqCVRMRHLSQEFGwLQITPQEFLCMKALLLFSIIPVDGLKnQKFFDELR 168 human
Q7T1K4    610 RSFKNVNSRMLYFAPDLVFNEYRMHKSRMYsqCVRMRHLSQEFGwLQVTPEEFLCDEGPSALSIIPVEGLKdQKCFDELR 689 bullfrog
Q8JH77    166 RSFTNVNSRMLYFAPDLVFNEYRMHKSRMYsqCIRMRHLSQEFGwLQITPQEFLCMKALLFFSIIPVDGLKnQKLFDELR 245 Taeniopygia guttata
Q9YGV9    682 RSFKNVKSRMLYFAPDLVFNEHRMQVSTMYehCIRMKNFSQEFAmLQVSQEEFLCMKALLLFSTIPVEGLKgQNFFDELR 761 Japanese eel
1XJ7_A     90 RSFTNVNSRMLYFAPDLVFNEYRMHKSRMYsqCVRMRHLSQEFGwLQITPQEFLCMKALLLFSIIPVDGLKnQKFFDELR 169 human
1T73_A    102 RSFTNVNSRMLYFAPDLVFNEYRMHKSRMYsqCVRMRHLSQEFGwLQITPQEFLCMKALLLFSIIPVDGLKnQKFFDELR 181 chimpanzee
1T5Z_A     84 RSFTNVNSRMLYFAPDLVFNEYRMHKSRMYsqCVRMRHLSQEFGwLQITPQEFLCMKALLLFSIIPVDGLKnQKFFDELR 163 human
1XOW_A     82 RSFTNVNSRMLYFAPDLVFNEYRMHKSRMYsqCVRMRHLSQEFGwLQITPQEFLCMKALLLFSIIPVDGLKnQKFFDELR 161 human
2Q7K_A     90 RSFTNVNSRMLYFAPDLVFNEYRMHKSRMYsqCVRMRHLSQEFGwLQITPQEFLCMKALLLFSIIPVDGLKnQKFFDELR 169 human
Feature 1                                              #   #                                  
2AX9_A    169 MNYIKELDRIIackrknptSCSRRFYQLTKLLDSVQPIARELHQFTFDLLiks--hmvSVDFPEMMAEIISVQVPKILSG 246 human
Q7T1K4    690 MNYIKELDRVIsckrnnpaSSSPRFFNLPKLLGSVQPIDVNLVQFTFGLFgka--qmvSVDFPEMMSEIISVQVPKILSG 767 bullfrog
Q8JH77    246 MNYIKELDRIIackrknptSCSRRFYQLTKVLDSVHPIAKDLHQFTFDLLika--hmvSVDYPEMMAEIISVQVPKILSG 323 Taeniopygia guttata
Q9YGV9    762 RSYINELDRLVsfr--sksSCSERFQQLTRLLDSLQPVLKKLHQFTFDLFvqsqnlsnQVCFPEMISEIISVHVPKILAG 839 Japanese eel
1XJ7_A    170 MNYIKELDRIIackrknptSCSRRFYQLTKLLDSVQPIARELHQFTFDLLiks--hmvSVDFPEMMAEIISVQVPKILSG 247 human
1T73_A    182 MNYIKELDRIIackrknptSCSRRFYQLTKLLDSVQPIARELHQFTFDLLiks--hmvSVDFPEMMAEIISVQVPKILSG 259 chimpanzee
1T5Z_A    164 MNYIKELDRIIackrknptSCSRRFYQLTKLLDSVQPIARELHQFTFDLLiks--hmvSVDFPEMMAEIISVQVPKILSG 241 human
1XOW_A    162 MNYIKELDRIIackrknptSCSRRFYQLTKLLDSVQPIARELHQFTFDLLiks--hmvSVDFPEMMAEIISVQVPKILSG 239 human
2Q7K_A    170 MNYIKELDRIIackrknptSCSRRFYQLTKLLDSVQPIARELYQFTFDLLiks--hmvSVDFPEMMAEIISVQVPKILSG 247 human
Feature 1             
2AX9_A    247 KVKPIYFH 254 human
Q7T1K4    768 RVKPLYFH 775 bullfrog
Q8JH77    324 KVKPIYFH 331 Taeniopygia guttata
Q9YGV9    840 TVKPILFH 847 Japanese eel
1XJ7_A    248 KVKPIYFH 255 human
1T73_A    260 KVKPIYFH 267 chimpanzee
1T5Z_A    242 KVKPIYFH 249 human
1XOW_A    240 KVKPIYFH 247 human
2Q7K_A    248 KVKPIYFH 255 human

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap