1PDU


Conserved Protein Domain Family
NR_LBD_DHR38_like

?
cd07072: NR_LBD_DHR38_like 
Click on image for an interactive view with Cn3D
Ligand binding domain of DHR38_like proteins, members of the nuclear receptor superfamily
The ligand binding domain of nuclear receptor DHR38_like proteins: DHR38 is a member of the steroid receptor superfamily in Drosophila. DHR38 interacts with the USP component of the ecdysone receptor complex, suggesting that DHR38 might modulate ecdysone-triggered signals in the fly, in addition to the ECR/USP pathway. At least four differentially expressed mRNA isoforms have been detected during development. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, DHR38 has a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).
Statistics
?
PSSM-Id: 132757
View PSSM: cd07072
Aligned: 6 rows
Threshold Bit Score: 446.195
Threshold Setting Gi: 215504293
Created: 11-Dec-2008
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
heterodimerputative
Conserved site includes 8 residues -Click on image for an interactive view with Cn3D
Feature 1:heterodimer interface [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1           #  #  ##  #                                                                  
1PDU_A        11 GAISLITALVRSHVDTTPDPSCLDYSHYEeqs-------mseADKVQQFYQLLTSSVDVIKQFAEKIPGYfDLLPEDQEL 83  fruit fly
EEA58480     311 PPVSLITALVRAHVDSSPSPPTLNYNLQFkmpgeegespksdTERVQQFYDLLCSSIEVIRTWAEKIPGFpDLLKEDQEL 390 Florida lancelet
XP_623987    549 SPVSLITALVRAHLDTTPDQASLDYSQYRqpspgd--ppiteAEKTQQFYNLLTTSIDVIRTFADKIPGFtDLVREDQEL 626 honey bee
XP_001944711 489 PPVSLITAIVRAHVDTNPDFSSLDYSQYHepkpfe--pliteAEKIQQFFGLLTTSVEVIRHFAEKIPGFkTLCKSDQDL 566 pea aphid
EEC13787     356 PPVSLITALVRAHVDTSPDLVNRDYSSVSerallr--lllrtASEVQQFYSLLTSSVDYIKAFSEKIPGFsELDRSDQEL 433 black-legged tick
P49870       122 PPISLITALVRAHVDTSPDFANLDYSQYRepsple--ppmsdLEVIQQFYSLLTTSIDMIKLFAEKVPGYgDLCPEDREQ 199 domestic silkworm
Feature 1                                                                      #                 
1PDU_A        84 LFQSASLELFVLRLAYRARIDDTKLIFCNGTVLHRTQCLRSFGEWLNDIMEFSRSLHNLEIDISAFACLCALTLITERHG 163 fruit fly
EEA58480     391 LFQSACLELFVLRLAYRSAPSEERLVFCNGAVLHQQQCVRSFGEWINYIMEFSKSLHAMNVDISAFACMAALVLITERHG 470 Florida lancelet
XP_623987    627 LFQSASLELFVLRLAYRTKPEDTKLTFCNGVVLALEQCQRSFGDWLHSILEFSKALHILDVDASAFACLCALTLVTARYG 706 honey bee
XP_001944711 567 LFQSASLELFVLRLAYRTKYADTKLIFCNGVVLDKQQCHRSFGDWLQAILDFSQSLHSLDIDISSFSCLCALTLITERHG 646 pea aphid
EEC13787     434 LFQSASLELFALRLAYRIRQDDDEFTFCNGVVLHRSQCERIFGDWLGAIFEFSQSLHAMQIDISAFACLAALTLVTERHG 513 black-legged tick
P49870       200 LFASARLELFVLRLAYRTALEDTKLTFSNGSVLDKRQCQRSFGDWLHAVLDFSNTSYSMDIDISTFACLCALTLITDRHG 279 domestic silkworm
Feature 1                           #   #                                                        
1PDU_A       164 LREPKKVEQLQMKIIGSLRDHVTYNaeaq-kkqHYFSRLLGKLPELRSLSVQGLQRIFYLKLEDLVPAPALIENMFVTTL 242 fruit fly
EEA58480     471 LKEPEKVEELQNKIISSLRDHVTYNvhaq-nrpHYFSKLLVKLPELRTLSVQGLQRIFYLKLEDLLPTPPMIDNLFLDTL 549 Florida lancelet
XP_623987    707 LKEPHRMEQLQSKIISSLRDHVTYNaeaq-rkaHYLSRLLGKLPELRSLSVQGLQRIFYLKLEDLVPAPPMIETMFVGSL 785 honey bee
XP_001944711 647 LREAKKTEQIQMKIITSLREHIAYSmsdsqrksYYFSRLLAKLTELRSLSLQGLQRIFYLKLEDLVPAPPLIENMFIASL 726 pea aphid
EEC13787     514 LKDCAKVEQLQMKIVSSLRDHVTYNseaq-kkpHYFSRLLAKLPDLRSLSLQGLQRIFYLKLEELVPAPAVIENMFVSSL 592 black-legged tick
P49870       280 LKEPHRVEQVQMKIIGCLRGHMPGGggss-sgaAPLQRVLGALPELRSLSVKASQRIFYLKLEDLVPAPPLIENMFRASL 358 domestic silkworm
Feature 1          
1PDU_A       243 PF 244 fruit fly
EEA58480     550 PF 551 Florida lancelet
XP_623987    786 PF 787 honey bee
XP_001944711 727 PF 728 pea aphid
EEC13787     593 PF 594 black-legged tick
P49870       359 PF 360 domestic silkworm

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap