1OVL,1OVL


Conserved Protein Domain Family
NR_LBD_Nurr1

?
cd07071: NR_LBD_Nurr1 
Click on image for an interactive view with Cn3D
The ligand binding domain of Nurr1, a member of conserved family of nuclear receptors
The ligand binding domain of nuclear receptor Nurr1: Nurr1 belongs to the conserved family of nuclear receptors. It is a transcription factor that is expressed in the embryonic ventral midbrain and is critical for the development of dopamine (DA) neurons. Structural studies have shown that the ligand binding pocket of Nurr1 is filled by bulky hydrophobic residues, making it unable to bind to ligands. Therefore, it belongs to the class of orphan receptors. However, Nurr1 forms heterodimers with RXR and can promote signaling via its partner, RXR. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, Nurr1 has a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).
Statistics
?
PSSM-Id: 132756
View PSSM: cd07071
Aligned: 6 rows
Threshold Bit Score: 478.756
Threshold Setting Gi: 154147678
Created: 11-Dec-2008
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
heterodimerputative
Conserved site includes 4 residues -Click on image for an interactive view with Cn3D
Feature 1:heterodimer interface [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                 #  #  #                                                                
1OVL_A        34 PVSLISALVRAHVDSNPAMTSLDYSRFQAnpdyqmsgDDTQHIQQFYDLLTGSMEIIRGWAEKIPGFaDLPKADQDLLFE 113 human
1OVL_B        34 PVSLISALVRAHVDSNPAMTSLDYSRFQAnpdyqmsgDDTQHIQQFYDLLTGSXEIIRGWAEKIPGFaDLPKADQDLLFE 113 human
XP_422166    361 PVSLISALVRAHVDSNPAMTSLDYSRFQAnpdyqmsgDDTQHIQQFYDLLTGSMEIIRGWAEKIPGFtDLPKTDQDLLFE 440 chicken
NP_001093678 354 PVSLISALVRAHVDSNPAVSSLDYSRFQAnpeyqmngDDTQHIQQFYDLLTGSMEIIRGWAEKIPGFsELHKQDQDLLFE 433 western clawed ...
NP_001106956 361 PVSLISALVRAHVDSNPSMNSLDYTRFQAnpdyqlsgDDTQHIQQFYDLLTGSMEIIRGWAEKIPGFtDLPKPDQDLLFE 440 zebrafish
AAT09761     354 PVNLLNALVRAHIDSNPSMARLDYSKFQTspeyhsggDESLHIQQFYDLLTASMSIIRGWAEKIPGFtELPKCDQELLFE 433 zebrafish
Feature 1                                                                  #                     
1OVL_A       114 SAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFGEWIDSIVEFSSNLQNXNIDISAFSCIAALAXVTERHGLKE 193 human
1OVL_B       114 SAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFGEWIDSIVEFSSNLQNXNIDISAFSCIAALAXVTERHGLKE 193 human
XP_422166    441 SAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFGEWIDSIVEFSSNLQNMNIDISAFSCIAALAMVTERHGLKE 520 chicken
NP_001093678 434 SAFLELFVLRLAYRSNPAEGKLIFCNGVVLNRLQCVRGFGEWIDSIVDFSSNLHSMNIDISAFSCIAALAVITERHGLKE 513 western clawed ...
NP_001106956 441 SAFLELFVLRLAYRSNPMESKLIFCNGVVLHRLQCVRGFGEWIDSIVEFSSNLQNMNLDISAFSCIAALAMVTERHGLKE 520 zebrafish
AAT09761     434 SAFLELFVLRLAYRSNLPEDKLIFCNGMVLHKLQCVRGFGEWIDSIVEFSSNLQSMSLDVSAFSCIAALTIVTERHGLKE 513 zebrafish
Feature 1                                                                                      
1OVL_A       194 PKRVEELQNKIVNCLKDHVtfnngglnrpnyLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF 271 human
1OVL_B       194 PKRVEELQNKIVNCLKDHVtfnngglnrpnyLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF 271 human
XP_422166    521 PKRVEELQNKIVNCLKDHVtfnngglnrpnyLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF 598 chicken
NP_001093678 514 PKRVEELQNKIVNCLKDHVtfnngglnrpnyLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF 591 western clawed frog
NP_001106956 521 PKRVEDLQNKIVNCLKDQVtfnggglnrpnyLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF 598 zebrafish
AAT09761     514 PKKAEELQNKLINCLKDQVscs-------geLSKLLEKLPEVRALCTQGLQRIFYLKLEDLVPTPAIIDKLFHDTLPF 584 zebrafish

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap