1YUC,1PK5,1YOK,1ZDU,1ZH7


Conserved Protein Domain Family
NR_LBD_Lrh-1

?
cd07069: NR_LBD_Lrh-1 
Click on image for an interactive view with Cn3D
The ligand binding domain of the liver receptor homolog-1, a member of nuclear receptor superfamily,
The ligand binding domain (LBD) of the liver receptor homolog-1 (LRH-1): LRH-1 belongs to nuclear hormone receptor superfamily, and is expressed mainly in the liver, intestine, exocrine pancreas, and ovary. Most nuclear receptors function as homodimer or heterodimers. However, LRH-1 binds DNA as a monomer, and is a regulator of bile-acid homeostasis, steroidogenesis, reverse cholesterol transport and the initial stages of embryonic development. Recently, phospholipids have been identified as potential ligand for LRH-1 and steroidogenic factor-1 (SF-1). Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, LRH-1 has a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).
Statistics
?
PSSM-Id: 132754
View PSSM: cd07069
Aligned: 8 rows
Threshold Bit Score: 486.457
Threshold Setting Gi: 33358129
Created: 10-Dec-2008
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
ligand bindinghomodimercorepressor
Conserved site includes 19 residues -Click on image for an interactive view with Cn3D
Feature 1:ligand binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                 #  ##                                  
1YUC_A        15 IPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKMADQTLFSIVEWARSSIFFRELKVDDQMKLLQN 94  human
1PK5_A         8 IPHLILELLKCEPDEPQVQAKIMAYLQQEQSNRNRQEKLSAFGLLCKMADQTLFSIVEWARSSIFFRELKVDDQMKLLQN 87  house mouse
1YOK_A        16 IPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKMADQTLFSIVEWARSSIFFRELKVDDQMKLLQN 95  human
1ZDU_A         5 IPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKMADQTLFSIVEWARSSIFFRELKVDDQMKLLQN 84  human
1ZH7_A         3 IPHLILELLKCEPDEPQVQAKIMAYLQQEQSNRNRQEKLSAFGLLCKMADQTLFSIVEWARSSIFFRELKVDDQMKLLQN 82  house mouse
NP_001081185 261 IPHLIVELLKCEPDEPQVQGKIMAYLQQEQANRSKHDKLNTFGLMCKMADQTLFSIVEWARSSIFFRDLKVDDQMKLLQN 340 African clawed ...
O42101       261 IPHLILELQKCEPDEPQVQAKIMAYLQQEQANRSKHEKLNTFGLMCKMADQTLFSIVEWARSSIFFRELKVDDQMKLLQN 340 chicken
AAK54449     277 FPHLVVELLKCEPDEPQVQAKILAYLQQEQASRGKHEKLNTFGLMCKMADQTLFSIVEWARSSIFFRELKVDDQMKLLQN 356 zebrafish
Feature 1         ##  #   #              #          #  ###  #  ##                                
1YUC_A        95 CWSELLILDHIYRQVVHGKEGSIFLVTGQQVDYSIIASQAGATLNNLMSHAQELVAKLRSLQFDQREFVCLKFLVLFSLD 174 human
1PK5_A        88 CWSELLILDHIYRQVAHGKEGTIFLVTGEHVDYSTIISHTEVAFNNLLSLAQELVVRLRSLQFDQREFVCLKFLVLFSSD 167 house mouse
1YOK_A        96 CWSELLILDHIYRQVVHGKEGSIFLVTGQQVDYSIIASQAGATLNNLMSHAQELVAKLRSLQFDQREFVCLKFLVLFSLD 175 human
1ZDU_A        85 CWSELLILDHIYRQVVHGKEGSIFLVTGQQVDYSIIASQAGATLNNLMSHAQELVAKLRSLQFDQREFVCLKFLVLFSLD 164 human
1ZH7_A        83 CWSELLILDHIYRQVAHGKEGTIFLVTGEHVDYSTIISHTEVAFNNLLSLAQELVVRLRSLQFDQREFVCLKFLVLFSSD 162 house mouse
NP_001081185 341 CWSELLILDHIFRQVLHGKEGSILLVTGQQVDYSVIVTQAGATLNNLMSHAQDLVAKLRSLQFDLREFVCLKFLVLFSLD 420 African clawed ...
O42101       341 CWSELLILDHIYRQVVHVKEGSILLVTGQQVDYSVIASQAGATLNNLMSHAQELVAKLRSLQFDLREFVCLKFLVLFSLD 420 chicken
AAK54449     357 CWSELLILDHVFRQVMHAKEGSILLVTGQQVDYALIASQAGATLNNLLSHAQELVSKLRSLQLDQREFVCLKFLVLFSLD 436 zebrafish
Feature 1                                                            #  ##  #                    
1YUC_A       175 VKNLENFQLVEGVQEQVNAALLDYTMCNYPQQTEKFGQLLLRLPEIRAISMQAEEYLYYKHLNGDVPYNNLLIEMLHAKR 254 human
1PK5_A       168 VKNLENLQLVEGVQEQVNAALLDYTVCNYPQQTEKFGQLLLRLPELRAISKQAEDYLYYKHVNGDVPYNNLLIEMLHAKR 247 house mouse
1YOK_A       176 VKNLENFQLVEGVQEQVNAALLDYTMCNYPQQTEKFGQLLLRLPEIRAISMQAEEYLYYKHLNGDVPYNNLLIEMLHAKR 255 human
1ZDU_A       165 VKNLENFQLVEGVQEQVNAALLDYTMCNYPQQTEKFGQLLLRLPEIRAISMQAEEYLYYKHLNGDVPYNNLLIEMLHAKR 244 human
1ZH7_A       163 VKNLENLQLVEGVQEQVNAALLDYTVCNYPQQTEKFGQLLLRLPEIRAISKQAEDYLYYKHVNGDVPYNNLLIEMLHAKR 242 house mouse
NP_001081185 421 VKTLENYQLVEGVQEQVNAALLDYTMCNYPQQTDKFGQLLLRLPEIRAISLQAEEYLYYKHLNGDVPCNNLLIEMLHAKR 500 African clawed ...
O42101       421 VKNLENFQLVEGVQEQVNAALLDYTMCNYPQQTDKFGQLLLRLPEIRAISMQAEEYLYCKHLNGDVPCNNLLIEMLHAKR 500 chicken
AAK54449     437 VKNLENFHLVESVQEQVNAALLDYVMCNYPQQTDKFGQLLLRLPEIRAISLQAEEYLYYKHLNGDVPCNNLLIEMLHAKR 516 zebrafish
Feature 1         
1YUC_A       255 A 255 human
1PK5_A       248 A 248 house mouse
1YOK_A       256 A 256 human
1ZDU_A       245 A 245 human
1ZH7_A       243 A 243 house mouse
NP_001081185 501 A 501 African clawed frog
O42101       501 A 501 chicken
AAK54449     517 A 517 zebrafish

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap