1SK8,1SK9,1QWO,1IHP,1DKM,1DKQ,1QFX,1NT4,2GFI,1CVI


Conserved Protein Domain Family
HP_HAP_like

?
cd07061: HP_HAP_like 
Click on image for an interactive view with Cn3D
Histidine phosphatase domain found in histidine acid phosphatases and phytases; contains a His residue which is phosphorylated during the reaction.
Catalytic domain of HAP (histidine acid phosphatases) and phytases (myo-inositol hexakisphosphate phosphohydrolases). The conserved catalytic core of this domain contains a His residue which is phosphorylated in the reaction. Functions in this subgroup include roles in metabolism, signaling, or regulation, for example Escherichia coli glucose-1-phosphatase functions to scavenge glucose from glucose-1-phosphate and the signaling molecules inositol 1,3,4,5,6-pentakisphosphate (InsP5) and inositol hexakisphosphate (InsP6) are in vivo substrates for eukaryotic multiple inositol polyphosphate phosphatase 1 (Minpp1). Phytases scavenge phosphate from extracellular sources and are added to animal feed while prostatic acid phosphatase (PAP) has been used for many years as a serum marker for prostate cancer. Recently PAP has been shown in mouse models to suppress pain by functioning as an ecto-5prime-nucleotidase. In vivo it dephosphorylates extracellular adenosine monophosphate (AMP) generating adenosine,and leading to the activation of A1-adenosine receptors in dorsal spinal cord.
Statistics
?
PSSM-Id: 132717
View PSSM: cd07061
Aligned: 114 rows
Threshold Bit Score: 58.9248
Threshold Setting Gi: 19075377
Created: 29-Sep-2008
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
catalytic core
Conserved site includes 6 residues -Click on image for an interactive view with Cn3D
Feature 1:catalytic core [active site]
Evidence:
  • Comment:The catalytic core includes a His group which is phosphorylated during phosphoryl transfer as well as two key Arg residues and an additional His residue which are hydrogen bonded to the phospho group before, during, and after transfer.
  • Structure:1NT4_A, Escherichia coli periplasmic glucose-1-phosphatase H18A mutant bound with glucose-1-phosphate, contacts calculated at 3.5 A.
    View structure with Cn3D
  • Structure:1SK9_A, Aspergillus fumigates phytase bound with phosphate ion, contacts calculated at 3.5 A.
    View structure with Cn3D
  • Structure:1DKQ_A, Escherichia coli phytase H17A mutant at pH5 bound with phytate having its 3-phosphate in the active site, contacts calculated at 3.5 A.
    View structure with Cn3D
  • Comment:E. coli phytase is expected to bind phytate similarly at pH5 as it does at its pH optimum of 4.5.
  • Citation:PMID 8407904
  • Citation:PMID 1429631

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                  ##  #                                                                  
1SK8_A         45 RITLVQVLSRHGARYPtsskskkykklvtaiqana--------------------------------------------- 79   Aspergillus f...
1NT4_A          8 QLQQVLMMSRANLRAPlanngsvleqst---------------------------------------------------- 35   Escherichia coli
XP_001628387  345 ELRCVIGIIRHGDRTPkqklkmeirhprfiqlfkrhnshnekklklkrpkqlqeildivrdlleehhagvtmfen----- 419  starlet sea a...
CAF91580      446 ELRCVIAVIRHGDRTPkqkmkmgspqphvtffdlfekyggyktgklklkkpkqlqevlditrqllaelgqhndcei---- 521  spotted green...
XP_413955     390 ELRCVIAVIRHGDRTPkqkmkmevkhprffelfekydgyktgklklkkpeqlqevldiarqlvvelgthsdceiee---- 465  chicken
Q6ZQB6        385 ELRCVIAVIRHGDRTPkqkmkmevrhqkffdlfekcdgyksgklklkkpkqlqevldiarqllmelgqnndseie----- 459  house mouse
NP_001088187  393 ELRCVIAVIRHGDRTPkqkmkmevrhqrffdlfekyhgyktgkiklkkpkqlqevldiarqllvelgqnndseie----- 467  African clawe...
Q9VR59        402 ELRCVVAVIRHGDRTPkqkmkvevrhpkffeifekydgyklghvklkrpkqlqeildiarfllseihtkahaeieekesk 481  fruit fly
Q06685        538 VFKGLAIIIRHADRTPkqkfkhsftspifisllkghkeevvirnvndlkivlqalrialdeka----------------- 600  baker's yeast
Q6FJ21        510 VFKGLVTVIRHADRTPkqkfkhsftspifisllkghkeevvirkvndlkivlqalrialeeka----------------- 572  Candida glabrata
Feature 1                                                                                         
1SK8_A         80 ---------------------------------------------------------tdfkgkfaflktynytlgaDDLT 102  Aspergillus f...
1NT4_A         36 -----------------------------------------------------------------pnkwpewdvpgGQLT 50   Escherichia coli
XP_001628387  420 -----------------pnklrqlknvlemyghfsginrkiqlkylgfvkdtpdssekayksskdeeaillimkwgGELT 482  starlet sea a...
CAF91580      522 ----------------eekkskleqlktvlemyghfsginrkvqltylphgqpktsseeedtrkegpslllvlkwgGELT 585  spotted green...
XP_413955     466 -----------------rkskleqlksvlemyghfsginrkvqltylphghpkaasedeearrepspslllvlkwgGELT 528  chicken
Q6ZQB6        460 -----------------enkskleqlktvlemyghfsginrkvqltylphgcpktsseeednrreepslllvlkwgGELT 522  house mouse
NP_001088187  468 -----------------eskakleqlktvlemyghfsginrkvqltylphgcpktsseeedcrreepslllvlkwgGELT 530  African clawe...
Q9VR59        482 leqlknvlemyghfsginrkvqmkyqpkgrprgsssddskssrispnpsasinqseanlaadqpvepslvlilkwgGELT 561  fruit fly
Q06685        601 ------------------------------gnpakikvlanalekklnfpgtkiqlkpvlnkenevekvqfilkwgGEPT 650  baker's yeast
Q6FJ21        573 ------------------------------gnptkikllantlekklelpgtkiqlkpvltqnnevekvqfilkwgGEPT 622  Candida glabrata
Feature 1                                                               #                         
1SK8_A        103 PFGEQQLVNSGIKFYQRYkala-------------------rsvVPFIRASGSDRVIASGEKFIEGFQqakladpgatnr 163  Aspergillus f...
1NT4_A         51 TKGGVLEVYMGHYMREWLaeqgmvks-----------gecpppyTVYAYANSLQRTVATAQFFITGAFpgc--------- 110  Escherichia coli
XP_001628387  483 ATGKIQAEELGRAFRCMYpggqgeysnlpg--cgllrlhstyrhDLKIYASDEGRVQMTAAAFAKGFL------------ 548  starlet sea a...
CAF91580      586 PAGRVQAEELGRAFRCMYpggqgdyagfpg--cgllrlhstyrhDLKIYASDEGRVQMTAAAFAKGLL------------ 651  spotted green...
XP_413955     529 PAGRVQAEELGRAFRCMYpggqgdyagfpg--cgllrlhstyrhDLKIYASDEGRVQMTAAAFAKGLL------------ 594  chicken
Q6ZQB6        523 PAGRVQAEELGRAFRCMYpggqgdyagfpg--cgllrlhstyrhDLKIYASDEGRVQMTAAAFAKGLL------------ 588  house mouse
NP_001088187  531 PAGRVQAEELGRAFRCMYpggqgdyagfpg--cgllrlhstyrhDLKIYASDEGRVQMTAAAFAKGLL------------ 596  African clawe...
Q9VR59        562 PAGRIQAEELGRIFRCMYpggqgrsdysgtqglgllrlhstfrhDLKIYASDEGRVQMTAAAFAKGLL------------ 629  fruit fly
Q06685        651 HSAKYQATELGEQMRQDFdllnk-----------------silqNIKIFSSSERRVLHTAQYWTRALFg----------- 702  baker's yeast
Q6FJ21        623 HSARYQATELGEQMRQDFdllnk-----------------nilqDIKIFSSSERRVLVSAQYWATALFg----------- 674  Candida glabrata
Feature 1                                                                                         
1SK8_A        164 aapAISvIIPESETfnntldhgvctkfeasqlgdevaan----------------------------------------- 202  Aspergillus f...
1NT4_A        111 -diPVH-HQEKMGTmdptfnpvitddsaafseqavaamekelsklqltdsyqlle------------------------- 163  Escherichia coli
XP_001628387  549 ---ALE-GELTPILvhlvrsdknttemldtsdqatklmtrvkqrlheilsqdkkftdedisklapt-------------- 610  starlet sea a...
CAF91580      652 ---ALE-GELTPILvqmvksanmnglldndsdslsscqhrvkarlheilqtdkgfsdedydrlapt-------------- 713  spotted green...
XP_413955     595 ---ALE-GELTPILvqmvksanmnglldsdsdslsscqhrvkarlheimqkdaefceedyeklapt-------------- 656  chicken
Q6ZQB6        589 ---ALE-GELTPILvqmvksanmnglldsdsdslsscqqrvkarlheilqkdrdftaedyekltps-------------- 650  house mouse
NP_001088187  597 ---ALE-GELTPILvqmvksanmnglldsdsdslsscqhrvkarlheilqrdrdfssedfeklspt-------------- 658  African clawe...
Q9VR59        630 ---ALE-GELTPILvqmvksantnglldndcdsskyqnlakgrlhelmqndrefskedrelinpcnsksi---------- 695  fruit fly
Q06685        703 ---ADE-LGSDEISirkdllddsnaakdlmdkvkkklkpllregkeappqfawpskmpepylvikrvvelmnyhkkimdn 778  baker's yeast
Q6FJ21        675 ---ADE-FSSDEINirkdllddsnaakdimdkvkkklkpllregketppqfawpakmpepylvikrvvelmnyhkkimdh 750  Candida glabrata
Feature 1                                                                                         
1SK8_A            --------------------------------------------------------------------------------      Aspergillus f...
1NT4_A            --------------------------------------------------------------------------------      Escherichia coli
XP_001628387  611 ----------------------------------------------------------------------------ksas 614  starlet sea a...
CAF91580      714 ----------------------------------------------------------------------------qsas 717  spotted green...
XP_413955     657 ----------------------------------------------------------------------------gsas 660  chicken
Q6ZQB6        651 ----------------------------------------------------------------------------gsis 654  house mouse
NP_001088187  659 ----------------------------------------------------------------------------gsvs 662  African clawe...
Q9VR59        696 ------------------------------------------------------------------------tqaldfvk 703  fruit fly
Q06685        779 nfakkdvnsmqtrwctsedpslfkerwdklfkefnnaekvdpskiselydtmkydalhnrqflenifdpglpneaiadel 858  baker's yeast
Q6FJ21        751 nfetkdvsklqerwctsedpglfkerwnkl---fkefvsvekadpskiselydtmkydalhnreflqnifdpgelaneni 827  Candida glabrata
Feature 1                                                                                         
1SK8_A        203 -----------------------ftalfapdiraraekhlpgvtltdeDVVSLMDMCSFDtvartsdasq---------- 249  Aspergillus f...
1NT4_A        164 -------kivnykdspackekqqcslvdgkntfsakyqqepgvsgplkVGNSLVDAFTLQyyegfpmdq----------- 225  Escherichia coli
XP_001628387  615 lieaikkvqnpremcaklanmvhdlteqlkdminqkkydprdpflyhdDTLELMTHRWIKldkdfrlkhgmydislipdi 694  starlet sea a...
CAF91580      718 lvnsmkiiqnpvatcdlvytliqsltsqirkrmedpksadlqlyhsetLELMLQRWSKLErdfrmkngrydiskipdiyd 797  spotted green...
XP_413955     661 llnsmtfiqnpveicnqvftlienltsqirkrledpksadlqlyhsetLELMLQRWSKLErdfrmkngrydiskipdiyd 740  chicken
Q6ZQB6        655 viksmhliknpvktcdkvysliqsltsqiryrmedpksadiqlyhsetLELMLRRWSKLEkdfktkngrydiskipdiyd 734  house mouse
NP_001088187  663 qiksmhfiknpvktcdkvysliqsltsqirqrmedpkfadiqlyhsetLELMLRRWSKLEkdfktkngrydiskipdiyd 742  African clawe...
Q9VR59        704 npvdcchhvhllirellhiisikkddpktkdailyhgetwdlmrcrweKIEKDFSTKSKLfdiskipdiydcikydlqhn 783  fruit fly
Q06685        859 gshslvdrypinvlaknnfkiidshsmnnsgknssnsvgslgwvlesgKTSTARNPKSSSqfdeprfmql---------- 928  baker's yeast
Q6FJ21        828 snhslvdrypinvlarnnfkivdssyaagtssssktsvgslgwvlesgKTKVNSESKSASpfdgqkyvqf---------- 897  Candida glabrata
Feature 1                                                                                         
1SK8_A        250 -------------------------lspfcqlftHNEWk--kYNYLQSLGKYYGYgag------npLGPAQGIGFTNELI 296  Aspergillus f...
1NT4_A        226 --------------------------vawgeiksDQQWk--vLSKLKNGYQDSLFts-------peVARNVAKPLVSYID 270  Escherichia coli
XP_001628387  695 ydgikydlqhnnqlglknttemynvakaladiviPQEYglsaEEKVKIARKMCIRll-------rkIQGDLKHADTEDTH 767  starlet sea a...
CAF91580      798 cvkydv--ihnaslgledtlelfrlsraladiviPQEYg---INKVEKLDIAYGYclplvrkiqmdLQRTHEDESVNKLH 872  spotted green...
XP_413955     741 cikydv--qhncalklegtaelfrfskaladviiPQEYg---INKEEKLEIAIGFclplikkiqldLQRTHEDESVNKLH 815  chicken
Q6ZQB6        735 cikydv--qhngslklentmelyrlskaladiviPQEYgi-tKAEKLEIAKGYCTplvrk--irsdLQRTQDDDTVNKLH 809  house mouse
NP_001088187  743 cikydv--qhncslklentmelyrlskaladiviPQEYgi-sRPEKLEIAKGYCTplvrk--irsdLQRTQDDDTVNKLH 817  African clawe...
Q9VR59        784 qh----------tlqydqaeelyiyaknladiviPQEYgl-tPQEKLAIGQGICSp---------lLRKIKGDLQRNIDE 843  fruit fly
Q06685        929 -------------------------relyklakvLFDFicpkEYGISDAEKLDIGl---------lTSLPLAKQILNDIG 974  baker's yeast
Q6FJ21        898 -------------------------relyrlakvLFDFicpkEYGIEDAEKLDIGl---------lTSLPLAKQILNDID 943  Candida glabrata
Feature 1                                             ##                                          
1SK8_A        297 ARLTrspvqdhtstnstlvsnpatfplnatMYVDFSHDNSMVSIFFALglyngteplsrtsvesakeldgysaswvVPFG 376  Aspergillus f...
1NT4_A        271 KALVtdrt------------------sapkITVLVGHDSNIASLLTALdfkpyql---------------hdqnerTPIG 317  Escherichia coli
XP_001628387  768 TRLNpeysqsvit--------phrhvrtrlYFTSESHVHSIINALRYGkmfesenqdaqwkr-aidflseipelhyMTQI 838  starlet sea a...
CAF91580      873 PLYSrgvmspg------------rhvrtrlYFTSESHVHSLLSIFRYGglldeekdpqwkr--amdylsavselnyMTQI 938  spotted green...
XP_413955     816 PLYSrgvlspg------------rhvrtrlYFTSESHVHSLLSIFRYGglldenkdqqwkr--amdylsaiselnyMTQI 881  chicken
Q6ZQB6        810 PVYSrgvlspe------------rhvrtrlYFTSESHVHSLLSILRYGalcddskdeqwkr--amdylnvvnelnyMTQI 875  house mouse
NP_001088187  818 PLYSrgvmspe------------rhvrtrlYFTSESHVHSLLSILRFGalcdetkdeqwkr--amdylnvvselnyMTQI 883  African clawe...
Q9VR59        844 VEDEfmnrlnphyshg--vaspqrhvrtrlYFTSESHVHSLLTVLRYGgllnvvtdeqwrr--amdyismvselnyMSQI 919  fruit fly
Q06685        975 DMKNretp------------------acvaYFTKESHIYTLLNIIYESgipmriar------------nalpeldyLSQI 1024 baker's yeast
Q6FJ21        944 IMKNkeap------------------acvaYFTKESHIYTLLNIIYESgipmrias------------nalpefdyLSQI 993  Candida glabrata
Feature 1                                
1SK8_A        377 ARAYFETMqcksekEPLVRALIN 399  Aspergillus fumigatus
1NT4_A        318 GKIVFQRWhdskanRDLMKIEYV 340  Escherichia coli
XP_001628387  839 VLMLYEDPta--dlQSDNRFHIE 859  starlet sea anemone
CAF91580      939 VIMLYEDNnk--dlSSEERFHVE 959  spotted green pufferfish
XP_413955     882 VIMLYEDNnk--dpSSEERFHVE 902  chicken
Q6ZQB6        876 VIMLYEDPnk--dlSSEERFHVE 896  house mouse
NP_001088187  884 VIMLYEDPnk--dvSSEERFHVE 904  African clawed frog
Q9VR59        920 VIMLYEDPtk--dpTSEERFHVE 940  fruit fly
Q06685       1025 TFELYESTdasgqkSHSIRLKMS 1047 baker's yeast
Q6FJ21        994 NFELYESTdanevkSHSIRLKMS 1016 Candida glabrata

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap