Conserved Protein Domain Family
BMC_PduA

?
cd07059: BMC_PduA 
1,2-propanediol utilization protein A (PduA), Bacterial Micro-Compartment (BMC) domain
PduA is encoded within the 1,2-propanediol utilization (pdu) operon along with other homologous carboxysome shell proteins PduB, B', J, K, T, and U. PduA is thought to be required for the formation of the outer shell of bacterial pdu polyhedral organelles which are involved in coenzyme B12-dependent degradation of 1,2-propanediol. Although it has been suggested that PduA might form hexamers and further assemble into the flat facets of the polyhedral outer shell of pdu organelles, like PduU does, at present no experimental evidence directly supports this view.
Statistics
?
PSSM-Id: 132899
View PSSM: cd07059
Aligned: 10 rows
Threshold Bit Score: 110.337
Threshold Setting Gi: 116619522
Created: 20-Nov-2008
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
HexamerPutative
Feature 1:Hexamer interface [polypeptide binding site]
Evidence:
  • Comment:Based on Synechocystis sp. CcmK2 (2A1B) and CcmK4 (2A10)

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1             #  #        #  ##     #    #  ###                              ### # ##  # 
NP_561819      6 ALGMIETRGLVGAIEAADAMVKAANVQLVGKEQVGGGLVTVMVRGDVGAVKAATDAGAAAAERVGDLISVHVIPRPHFEV 85  Clostridium per...
YP_925214      8 ALGMIETRGLVGSIEAADAMVKAANVTLIGKEHIGGGYVTVMVRGDVGAVKAATDAGAAAAQRVGDLVSVHVIPRPHGDV 87  Nocardioides sp...
NP_815336      6 ALGMIETRGLVGAVEAADAMVKAANVTLIGKEQVGGGLVTVMVRGDVGAVKAATDAGAAAAERVGELLSVHVIPRPHTEV 85  Enterococcus fa...
NP_602997      6 ALGMIETKGLVAAVEAADAMVKAANVTLVGKELVGGGLVTVMVRGDVGAVKAATDAGAAAADRVGELISVHVIPRPHSEV 85  Fusobacterium n...
YP_001996781   5 ALGMIETKGLVGAIEAADAMVKAANVDLIGKETIGGGFVTVMVRGDVGAVKAATDAGAAAAQRVGELVSVHVIPRPHSEV 84  Chloroherpeton ...
ZP_02034504  138 ALGMVETRGLVAAIEAADAMVKAANVQLVGKEQVGGGLVTVMVRGDVGAVKAATDAGAAAAEKVGELVSVHVIPRPHAEV 217 Bacteroides cap...
YP_821678      3 ALGMIETKGLTGAIEAADAMVKTANVVLIGKEFVGAGLVMVQVRGDVGAVKAATDAGAAAARRVGELVSVHVIPRPHEEV 82  Solibacter usit...
P0A1C7         5 ALGMVETKGLTAAIEAADAMVKSANVMLVGYEKIGSGLVTVIVRGDVGAVKAATDAGAAAARNVGEVKAVHVIPRPHTDV 84  Salmonella typh...
YP_425993      5 ALGMVETKGLVGAIEAADAMVKSANVVLMGYEKIGSGLVTVMVRGDVGAVKAATDAGAVAASKIGEVVSVHVIPRPHTEV 84  Rhodospirillum ...
YP_001023508  18 ALGLIETKGLVGAIEAADAMVKAANVRLVGREQIGGGLVTVMVRGDVGAVKAATDAGAAAAGKIGEIVSVHVIPRPHEDV 97  Methylibium pet...
Feature 1             
NP_561819     86 DAILP 90  Clostridium perfringens str. 13
YP_925214     88 EFILP 92  Nocardioides sp. JS614
NP_815336     86 DAILP 90  Enterococcus faecalis V583
NP_602997     86 ELILP 90  Fusobacterium nucleatum subsp. nucleatum ATCC 25586
YP_001996781  85 EAILP 89  Chloroherpeton thalassium ATCC 35110
ZP_02034504  218 DFVLP 222 Bacteroides capillosus ATCC 29799
YP_821678     83 EKILP 87  Solibacter usitatus Ellin6076
P0A1C7        85 EKILP 89  Salmonella typhimurium
YP_425993     85 EKILP 89  Rhodospirillum rubrum ATCC 11170
YP_001023508  98 EGILP 102 Methylibium petroleiphilum PM1

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap