2G13,2EWH


Conserved Protein Domain Family
BMC_CsoS1

?
cd07058: BMC_CsoS1 
Click on image for an interactive view with Cn3D
Carboxysome Shell 1 (CsoS1); Bacterial Micro-Compartment (BMC) domain
The cso operon in Halothiobacillus neapolitanus contains the genes involved in alpha carboxysome function including those for the carboxysome shell proteins: CsoS1A, CsoS1B, and CsoS1C. CsoS1A has been shown to form hexameric units which further assemble into the flat facets of the polyhedral carboxysome shell. The structures suggest that the central pores and the gaps between hexamers limit the transport of metabolites into and out of the the carboxysome. Although it has been suggested that other homologous proteins, CsoS1B and CsoS1C, in this family might also form hexamers and play similar functional roles in the construction of carboxysome outer shell at present no experimental evidence directly supports this view.
Statistics
?
PSSM-Id: 132898
View PSSM: cd07058
Aligned: 5 rows
Threshold Bit Score: 132.415
Threshold Setting Gi: 75343618
Created: 20-Nov-2008
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 17 residues -Click on image for an interactive view with Cn3D
Feature 1:Hexamer interface [polypeptide binding site]
Evidence:
  • Comment:Based on Synechocystis sp. CcmK2 (2A1B) and CcmK4 (2A10)

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1               #  #        #  ##     #    #  ###                               ### # ## 
2G13_A         6 GIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVH 85  Halothiobacillu...
2EWH_A         6 GIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVH 85  Halothiobacillu...
O84921         7 GIALGMIETRGLVPAIEAADAMTKAAEVRLIGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVH 86  Thiobacillus de...
ABD96255       7 GIALGMIETRGLVPAIEAADAMTKAAEVRLIGREFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARPH 86  uncultured mari...
YP_001238696   7 GIALGMIETRGLVPAIEAADAMTKASEVRLIGRQFVGGGYVTVMVRGETGAVNAAVRAGADACERVGDGLAAAHIIARPH 86  Bradyrhizobium ...
Feature 1         #      
2G13_A        86 SEVENILP 93  Halothiobacillus neapolitanus
2EWH_A        86 SEVENILP 93  Halothiobacillus neapolitanus
O84921        87 NEVENILP 94  Thiobacillus denitrificans
ABD96255      87 REVEPALG 94  uncultured marine type-A Synechococcus GOM 3M9
YP_001238696  87 IEVEHVLP 94  Bradyrhizobium sp. BTAi1

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap