1T8P,1SK8,2F90,1NT4,1SK9,1H2E,2IKQ,1DKQ,2GFI,1QFX,1IHP,1QWO,1DKM,1CVI,3F2I,2RFL,1UJB,3D8H,1YFK,1XQ9,3EZN,1E59,1RII,3PGM,1FZT,3E9C,3DCY,3EOZ,3F3K,2A6P,2QNI,2P6O,2AXN,1K6M


Conserved Protein Domain Family
HP

?
cd07040: HP 
Click on image for an interactive view with Cn3D
Histidine phosphatase domain found in a functionally diverse set of proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction.
Catalytic domain of a functionally diverse set of proteins, most of which are phosphatases. The conserved catalytic core of this domain contains a His residue which is phosphorylated in the reaction. This set of proteins includes cofactor-dependent and cofactor-independent phosphoglycerate mutases (dPGM, and BPGM respectively), fructose-2,6-bisphosphatase (F26BP)ase, Sts-1, SixA, histidine acid phosphatases, phytases, and related proteins. Functions include roles in metabolism, signaling, or regulation, for example F26BPase affects glycolysis and gluconeogenesis through controlling the concentration of F26BP; BPGM controls the concentration of 2,3-BPG (the main allosteric effector of hemoglobin in human blood cells); human Sts-1 is a T-cell regulator; Escherichia coli Six A participates in the ArcB-dependent His-to-Asp phosphorelay signaling system; phytases scavenge phosphate from extracellular sources. Deficiency and mutation in many of the human members result in disease, for example erythrocyte BPGM deficiency is a disease associated with a decrease in the concentration of 2,3-BPG. Clinical applications include the use of prostatic acid phosphatase (PAP) as a serum marker for prostate cancer. Agricultural applications include the addition of phytases to animal feed.
Statistics
?
PSSM-Id: 132716
View PSSM: cd07040
Aligned: 425 rows
Threshold Bit Score: 37.0081
Threshold Setting Gi: 74644936
Created: 8-Jan-2008
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
catalytic core
Conserved site includes 5 residues -Click on image for an interactive view with Cn3D
Feature 1:catalytic core [active site]
Evidence:
  • Comment:The catalytic core includes a His group which is phosphorylated during phosphoryl transfer as well as two key Arg residues and an additional His residue which are hydrogen bonded to the phospho group before, during, and after transfer.
  • Structure:1H2E_A, Bacillus stearothermophilus PhoE phosphatase bound with phosphate ion, contacts at 3.5A
    View structure with Cn3D
  • Structure:2IKQ_A, Mus musculus Sts-1 (Suppressor of T- Cell Receptor) phosphatase domain bound with phosphate ion, contacts at 3.5A.
    View structure with Cn3D
  • Structure:1SK8_A, Aspergillus fumigates phytase bound with phosphate ion, contacts at 3.5 A.
    View structure with Cn3D
  • Structure:1NT4_A, Escherichia coli periplasmic glucose-1-phosphatase H18A mutant bound with glucose-1-phosphate, contacts at 3.5 A.
    View structure with Cn3D
  • Structure:2F90_A, human bisphosphoglycerate mutase homodimer bound with 3-phosphoglycerate and Alf4-, contacts at 3.5 A.
    View structure with Cn3D
  • Comment:Alf4- mimics the intermediate in phosphoryl transfer reactions.
  • Citation:PMID 1429631
  • Citation:PMID 8407904

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1          ##                                                                         
1T8P_A      5 KLIMLRHGEGAwnkenr--------------------------------fcswvdQKLNSEGMEEARNCGKQLkaln--- 49  human
P45565     55 VVVLFRHAERCdrstnq---------------------------------clsdkTGITVKGTQDARELGNAFsadi--- 98  Escherichia coli
1H2E_A      3 TLYLTRHGETKwnverr--------------------------------mqgwqdSPLTEKGRQDAMRLGKRLeav---- 46  Geobacillus stearo...
2IKQ_A      6 CLFVCRHGERMdvvfgkywlsqcfdakgryirt-nlnmphslpqrsggfrdyekdAPITVFGCMQARLVGEALlesn--- 81  house mouse
Q90XY1     78 LTAIVRHGTRYptgknikkmhdfyelmkssavg-reswlqelqnqwtmwytedmdGRLVQKGVDDLKNLAVRLsklfpsm 156 Takifugu rubripes
Q6NY36     58 MVSVIRHGTRYpttknvrkiaqlfdlvksdslr-sasswlndlktwkmwytedmdGRLVEKGRDDHRHLAMRLaksfptl 136 zebrafish
Q9VCE9    493 KIYIMRHGERVdftfgtwipycfdefgnymrk--dlnmpktlprrknspegwqndSPLTNVGVYQANLIGQALleaq--- 567 fruit fly
Q22323      5 RVFIIRHGERCdfafgksglwinsfdsrgryrpldinlprtlpkradgwqgfaadTPLTEIGYLQSKLTGRALrdng--- 81  Caenorhabditis ele...
P57075    397 SVLVVRHGERVdqifgkawlqqcstpdgkyyrp-dlnfpcslprrsrgikdfendPPLSSCGIFQSRIAGDALldsg--- 472 human
Q7YTB0     74 WVFALRHGERVdltygpwvphcfendtyvrkd---lnlplklahraggkggyvkdTPLTRLGWFQAQLVGEGMrmag--- 147 domestic silkworm
Feature 1                        #                                                            
1T8P_A     50 -------fefdLVFTSVLNRSIHTAWLILeelg-qewvPVE-SSWRlnerhygaliglnreqmalnhgeeqvrlwrrsyn 120 human
P45565     99 --------pdfDLYSSNTVRTIQSATWFSag------kKLT-VDKRllq------------------------------- 132 Escherichia coli
1H2E_A     47 --------elaAIYTSTSGRALETAEIVRggr----liPIY-QDERlreihlgdwegkthdeirqmdpia---------- 103 Geobacillus stearo...
2IKQ_A     82 -------tvidHVYCSPSLRCVQTAHNILkglqqdnhlKIR-VEPGlfewtkwvagstlpawippselaaan-------- 145 house mouse
Q90XY1    157 iseeklragmiKFITSSKHRCVNSTLSFKagl----teLWAiSDQEiehtvndalmrffdqctrfvqevdgnpsalseve 232 Takifugu rubripes
Q6NY36    137 isadhlranriEFMTSSKHRCVDSVKAFQegl----hrLWDvQDMDyqhyvddslmryfdhcekfvegvennktalkevq 212 zebrafish
Q9VCE9    568 -------vqidHVYCSPSYRCIQTCTSALeglkltgkqKIK-LEPGlfewmawypsgvpdwltknelteakfd------- 632 fruit fly
Q22323     82 -------ieinHVFCSPALRCIQTTVGLLkgmgldkriQFS-VEPGlyewmvfaryarpcwippkdlkklgy-------- 145 Caenorhabditis ele...
P57075    473 -------irisSVFASPALRCVQTAKLILeelklekkiKIR-VEPGifewtkweagkttptlmsleelkean-------- 536 human
Q7YTB0    148 -------vsikHVYASPALRCVETAQGFLdglradpsvKIK-VEPGlfefknwhmpkgidfmtpielckag--------- 210 domestic silkworm
Feature 1                                                                                     
1T8P_A    121 vtpp--------------------------------------------pieeshpyyqeiyndrrykvcdvpldqlprse 156 human
P45565        --------------------------------------------------------------------------------     Escherichia coli
1H2E_A    104 ---------------------------------------------------------------fdhfwqaphlyapqrge 120 Geobacillus stearo...
2IKQ_A    146 ------------------------------------------------------------lsvdttyrphipvsklaise 165 house mouse
Q90XY1    233 sfrlgpemrrvqekiaerlrvpysditcdsaeaafylcayefaiktvnspwcrlfdqvdaqimeyandlkqfwkrgyghd 312 Takifugu rubripes
Q6NY36    213 rfksssemdsvrrkissrlqipydritadmaeaafflcsyefaikseyspwcelldesdaqvleykndlkqywkrgyghd 292 zebrafish
Q9VCE9    633 ------------------------------------------------------------vdldyepvqpaseltarlke 652 fruit fly
Q22323    146 -------------------------------------------------------------pvqenyvpcwtdkelrmne 164 Caenorhabditis ele...
P57075    537 ------------------------------------------------------------fnidtdyrpafplsalmpae 556 human
Q7YTB0    211 --------------------------------------------------------------lnvdmtykpyvemdasae 228 domestic silkworm
Feature 1                                            ##                                       
1T8P_A    157 slkdvlERLLPYWNERiapev--------lrgkTILISAHGNSSRALLKHLegisdedi---------------initlp 213 human
P45565    133 ----cgNEIYSAIKDLqska----------pdkNIVIFTHNHCLTYIAKDKrdatfk-------------------pdyl 179 Escherichia coli
1H2E_A    121 rfcdvqQRALEAVQSIvdrh----------egeTVLIVTHGVVLKTLMAAFkdtpldhlw--------------sppymy 176 Geobacillus stearo...
2IKQ_A    166 sydtyiNRSFQVTKEIiseck--------skgnNILIVAHASSLEACTCQLqglspqnskdf----------vqmvrkip 227 house mouse
Q90XY1    313 inskssCILFHDLFSRlekavsdhksgqkvteaVTVQVGHAKTLLPLLTLLgffkdnnrmtsvnyaaqtrrsfrtslmvp 392 Takifugu rubripes
Q6NY36    293 inrkssCPLFHDIFSRldnaakdh-rfgevkktATIQVGHGETLLPLLSLMgffkdekpltsenfalqrkrvfrsskilp 371 zebrafish
Q9VCE9    653 steqfyERNHDVILQLleq-----------ttgNILVVAHATTLDTCSRQLtggvprstnel----------rqvihkip 711 fruit fly
Q22323    165 tladfyQRSFGSINKIlsec----------tegNILIVAHGASLETCTRQLvggdirstddf----------yyllqntp 224 Caenorhabditis ele...
P57075    557 syqeymDRCTASMVQIvntcp--------qdtgVILIVSHGSTLDSCTRPLlglpprecgdf----------aqlvrkip 618 human
Q7YTB0    229 tmdeffKRGEVAMQAAvndte--------kdggNVIFIGHAITLDQMVGALhrlrddmedvqpy------eigrnllkvp 294 domestic silkworm
Feature 1                           
1T8P_A    214 tgVPILLElden-lraVGpHQF 234 human
P45565    180 dgLVMHVE--------KGkVYL 193 Escherichia coli
1H2E_A    177 gtSVTIIEvdg--gtfHVaVEG 196 Geobacillus stearothermophilus
2IKQ_A    228 ylGFCSCEelgetgiwQL-TDP 248 house mouse
Q90XY1    393 yaANLVLVlydcgnddLRlQPL 414 Takifugu rubripes
Q6NY36    372 yaANVVFVlyec-sdgLRvQLF 392 zebrafish
Q9VCE9    712 ycSLATVEqvd--gvwKL-VEP 730 fruit fly
Q22323    225 ylSCVEVNsre--glwRL-VGS 243 Caenorhabditis elegans
P57075    619 slGMCFCEenkeegkwEL-VNP 639 human
Q7YTB0    295 ycALGAMRgk----pwDV-VSP 311 domestic silkworm

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap