1POW,1Y9D,1V5F,3EYA


Conserved Protein Domain Family
TPP_PYR_POX

?
cd07039: TPP_PYR_POX 
Click on image for an interactive view with Cn3D
Pyrimidine (PYR) binding domain of POX.
Thiamine pyrophosphate (TPP family), pyrimidine (PYR) binding domain of pyruvate oxidase (POX) subfamily. The PYR domain is found in many key metabolic enzymes which use TPP (also known as thiamine diphosphate) as a cofactor. TPP binds in the cleft formed by a PYR domain and a PP domain. The PYR domain, binds the aminopyrimidine ring of TPP, the PP domain binds the diphosphate residue. The PYR and PP domains have a common fold, but do not share strong sequence conservation. The PP domain is not included in this sub-family. Most TPP-dependent enzymes have the PYR and PP domains on the same subunit although these domains can be alternatively arranged in the primary structure. TPP-dependent enzymes are multisubunit proteins, the smallest catalytic unit being a dimer-of-active sites. Lactobacillus plantarum POX is a homotetramer (dimer-of-homodimers), having two active sites per homodimer lying between PYR and PP domains of different subunits. POX decarboxylates pyruvate, producing hydrogen peroxide and the energy-storage metabolite acetylphosphate.
Statistics
?
PSSM-Id: 132922
View PSSM: cd07039
Aligned: 38 rows
Threshold Bit Score: 215.878
Threshold Setting Gi: 94496086
Created: 22-Dec-2008
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 4 residues -Click on image for an interactive view with Cn3D
Feature 1:TPP binding site [chemical binding site]
Evidence:
  • Structure:1Y9D_A/ C; Lactobacillus plantarum POX (variant V265a) homodimer binds TPP and divalent metal ion; contacts at 3.5A.
    View structure with Cn3D
  • Comment:L. plantarum POX is a tetramer (dimer-of-homodimers). There are two TPP-binding sites per homodimer.
  • Comment:each TPP binds in a site lying between a PYR domain and a PP domain from different subunits.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                             #                           #                      #      #
1POW_A         4 LAGAAVIKVLEAWGVDHLYGIPGGSINSIMDALsae--rdrIHYIQVRHEEVGAMAAAADAKLTgkIGVCFGSAGPGGTH 81  Lactobacillus p...
1Y9D_A        12 LAGAAVIKVLEAWGVDHLYGIPGGSINSIMDALsae--rdrIHYIQVRHEEVGAMAAAADAKLTgkIGVCFGSAGPGGTH 89  Lactobacillus p...
YP_001424132   5 NVWEMLLDILDGCSNRQIFGVFGDAINPLANALrtdk-rkrFEWIAVRHEETGAFAAGAQAKLTgkLGLCAGTVGPGAIH 83  Coxiella burnet...
ZP_01306645    2 KVSDLFVKVLKQHGVRYLFGIPGDAINDLMESVrke---egIEFIQVKHEEAGALAASVQAKLTgkLTACVGTSGPGAIH 78  Oceanobacter sp...
NP_342490      3 SVAEVIIRVLEDNGIQRIYGIPGDSIDPLVDAIrk----skVKYVQVRHEEGAALAASVEAKITgkPSACMGTSGPGSIH 78  Sulfolobus solf...
ZP_01188115    4 KVSEVIIEQLHNFGVKHIYGYAGDTILKFFSKLkg----spVKLFTTKHESTAGFMASAEAKLTgnLGVCIAHSGPGTTN 79  Halothermothrix...
ZP_03333293   64 TVGEVIIDHLAASGIRYVFGIPGTSSLGLVDAIrkk---egIEYIIVRHEANGAMAAAAYGKLTglPAVCLTIGGPGATN 140 Candidatus Meth...
YP_889828    118 TVSDVLVETMTNWGVDTVFGMVGHSNLGLAEAMhraenagkLRYFGIRHEGAAAFAASAYGKLTgrPAACFGIAGPGSTN 197 Mycobacterium s...
YP_001761044 114 TISDVMVETMVNWGVNRVFGMVGHSNLGMADALrrqeeqgnLKFIGIRHEGAASFAASAYGKLTgkPAACFAIAGPGSTN 193 Shewanella wood...
NP_275619     53 TVSEVFISQLAAWGLKYVFGIPGTSTLGLVDALrrn---deIRYIQVRHEAAAAFMASSYGKLTgqPAVCMAVAGPRASN 129 Methanothermoba...
Feature 1                                                                                        
1POW_A        82 LMNGLYDAREDHVPVLALIGQFGTTGMNMDTFQEMNENPIYADVADYNVTAVNAATLPHVIDEAIRRAYAHQGVAVVQIP 161 Lactobacillus p...
1Y9D_A        90 LMNGLYDAREDHVPVLALIGQFGTTGMNMDTFQEMNENPIYADVADYNVTAVNAATLPHVIDEAIRRAYAHQGVAVVQIP 169 Lactobacillus p...
YP_001424132  84 LLNGLYDAKMDHAPVLALTGQVPRDEIGTDYHQEVNLDRLFDDVSAYNESLIVPEQMPRLGLLAVQTAIARQGVAHLSIP 163 Coxiella burnet...
ZP_01306645   79 LLNGLYDAKMDHAPVLAITGQVETQYMGTNYHQEVDLERLFSDVSCYSQTVTTANQLPDVLLEACRAAISGRTVAHLNLP 158 Oceanobacter sp...
NP_342490     79 LLNGLYDAKMDHAPVIALTGQVESDMIGHDYFQEVNLTKLFDDVAVYNQILINPENAEYIIRRAIREAISKRGVAHINLP 158 Sulfolobus solf...
ZP_01188115   80 IINGIADAYSDRVPLLLITGQVPTYNIGTDYKQYVDQLKLTEPLTVYSSILINPATVIDIFYKAMTMSILKGGVSHIVIP 159 Halothermothrix...
ZP_03333293  141 LATGLYDAKEDHAPLIALNGQVEHQYTGPGGFQEIDQDAFFRPITVYNTTIHDRSKTVQIMTTALKSAILQHGVAQVSVP 220 Candidatus Meth...
YP_889828    198 LLTGLYDAKADRAPVLALSGNVESAVAGKGAFQDIDLLAAFADVAVYSEMVRDGSEHAELMTMALKHAILERGVAHLVVP 277 Mycobacterium s...
YP_001761044 194 MFTGLWDAKVDRAPILALTGQVATQVVGTGNFQEVDLINAFNSVAEFNHRVEHKSKHSELMSLAIKTAIIKRDVSHLTFP 273 Shewanella wood...
NP_275619    130 LITGLLDAALDRAPVLAVTGHVETYRIGTGASQEIDQHSLFESFSVYNMTLVSPDEAAEIAREAVKHAILERGVSHVDVP 209 Methanothermoba...
Feature 1               
1POW_A       162 VDLPWQQ 168 Lactobacillus plantarum
1Y9D_A       170 VDLPWQQ 176 Lactobacillus plantarum
YP_001424132 164 TDVGPSK 170 Coxiella burnetii Dugway 5J108-111
ZP_01306645  159 SDIAQKQ 165 Oceanobacter sp. RED65
NP_342490    159 VDILRKS 165 Sulfolobus solfataricus P2
ZP_01188115  160 MDLWDQE 166 Halothermothrix orenii H 168
ZP_03333293  221 NNIQKQP 227 Candidatus Methanosphaerula palustris E1-9c
YP_889828    278 DEVQVIQ 284 Mycobacterium smegmatis str. MC2 155
YP_001761044 274 DEVQELP 280 Shewanella woodyi ATCC 51908
NP_275619    210 RDVQTME 216 Methanothermobacter thermautotrophicus str. Delta H

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap