Conserved Protein Domain Family
NR_DBD_PNR

?
cd06970: NR_DBD_PNR 
DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) is composed of two C4-type zinc fingers
DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. PNR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. PNR is a member of the nuclear receptor superfamily of the ligand-activated transcription factors. PNR is expressed only in the outer layer of retinal photoreceptor cells. It may be involved in the signaling pathway regulating photoreceptor differentiation and/or maintenance. It most likely binds to DNA as a homodimer. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, PNR has a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).
Statistics
?
PSSM-Id: 143528
View PSSM: cd06970
Aligned: 8 rows
Threshold Bit Score: 179.753
Threshold Setting Gi: 195027481
Created: 3-Feb-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
zinc bindingputative DNA
Feature 1:zinc binding site [ion binding site]
Evidence:
  • Comment:Zinc finger, C4-type: The domain contains two groups of four Cys residues. Each group is involved in the co-ordination of a single zinc atom
  • Comment:coordination residues derived from related proteins

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                #  #             #  #               #      #         #  #               
NP_989925     27 KALSPVLLCKVCGDTSSGKHYGIYACNGCSGFFKRSVRRKLIYRCQAGTGLCPVDKAHRNQCQACRLKKCLQAGMNKDAV 106 chicken
NP_001090633  24 PAPNPHLLCRVCGDSSSGKHYGIFACNGCSGFFKRSVRRKLIYRCQAGTGLCPVDKAHRNQCQACRLKKCLQTGMNKDAV 103 western clawed ...
NP_001007369  31 KVLNTGLLCKVCSDTSSGKHYGIYACNGCSGFFKRSVRRRLIYRCQAGTGMCPVDKAHRNQCQACRLKKCLQAGMNKDAV 110 zebrafish
NP_055064     39 TGVSPSLQCRVCGDSSSGKHYGIYACNGCSGFFKRSVRRRLIYRCQVGAGMCPVDKAHRNQCQACRLKKCLQAGMNQDAV 118 human
NP_611032    103 KGQNLGLICVVCGDTSSGKHYGILACNGCSGFFKRSVRRKLIYRCQAGTGRCVVDKAHRNQCQACRLKKCLQMGMNKDAV 182 fruit fly
XP_780706     25 KRICPGLTCTVCGDISSGKHYGIYACNGCSGFFKRSVRRKLVYRCQAGTGCCLVDKAHRNQCQACRLKKCLDAGMNKDAV 104 purple urchin
XP_001986611  91 KGQNLGLICVVCGDTSSGKHYGILACNGCSGFFKRSVRRKLIYRCQAGTGRCIVDKAHRNQCQACRLKKCLLMGMNKDAV 170 Drosophila grim...
NP_508547     94 TASSPTLCCAVCGDVSSGKHYGILACNGCSGFFKRSVRRRLIYRCQAGTGNCVVDKAHRNQCQACRLKKCLNKGMNKDAV 173 nematode
Feature 1                    
NP_989925    107 QNERQPRSTAQV 118 chicken
NP_001090633 104 QNERQPRSTAQI 115 western clawed frog
NP_001007369 111 QNERQPRSTAQV 122 zebrafish
NP_055064    119 QNERQPRSTAQV 130 human
NP_611032    183 QNERQPRNTATI 194 fruit fly
XP_780706    105 QNERQPRNMAHV 116 purple urchin
XP_001986611 171 QNERQPRNTATI 182 Drosophila grimshawi
NP_508547    174 QNERQPRNTATI 185 nematode

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap