1CIT


Conserved Protein Domain Family
NR_DBD_NGFI-B

?
cd06969: NR_DBD_NGFI-B 
Click on image for an interactive view with Cn3D
DNA-binding domain of the orphan nuclear receptor, nerve growth factor-induced-B
DNA-binding domain (DBD) of the orphan nuclear receptor, nerve growth factor-induced-B (NGFI-B) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. NGFI-B interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. NGFI-B is a member of the nuclear-steroid receptor superfamily. NGFI-B is classified as an orphan receptor because no ligand has yet been identified. NGFI-B is an early immediate gene product of embryo development that is rapidly produced in response to a variety of cellular signals including nerve growth factor. It is involved in T-cell-mediated apoptosis, as well as neuronal differentiation and function. NGFI-B regulates transcription by binding to a specific DNA target upstream of its target genes and regulating the rate of transcriptional initiation. NGFI-B binds to the NGFI-B response element (NBRE) 5'-(A/T)AAAGGTCA as a monomer. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, NGFI-B has a central well-conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).
Statistics
?
PSSM-Id: 143527
View PSSM: cd06969
Aligned: 13 rows
Threshold Bit Score: 125.25
Threshold Setting Gi: 4930008
Created: 2-Feb-2009
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
zinc bindingDNA binding
Conserved site includes 8 residues -Click on image for an interactive view with Cn3D
Feature 1:zinc binding site [ion binding site]
Evidence:
  • Structure:1CIT_A; C4 type zinc finger of Rattus norvegicus monomeric orphan nuclear receptor NGFI-B,contacts at 4A
    View structure with Cn3D
  • Comment:Zinc finger, C4-type: The domain contains two groups of four Cys residues. Each group is involved in the co-ordination of a single zinc atom.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1           #  #             #  #               #      #         #  #                 
1CIT_A          1 GRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKSAKYICLA-NKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRT 75   Norway rat
NP_001071779  713 GLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKKSTYVCLA-NRNCPVDKRRRNRCQFCRFEKCLAVGMVKEVVRT 787  Ciona intestinalis
XP_786266     386 GMCAVCGDSAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLA-NKNCTVDKRRRNRCQYCRFQKCLACGMVKEVVRT 460  purple urchin
AAY85266      253 GTCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLA-SKNCPVDKRRRNRCQYCRFQKCLSVGMVKEVVRT 327  zebrafish
NP_001071780  484 GSCAVCGDKARWQHYGVLACEGCKGFFKRSVQKDARYVCLG-NSNCPIDKKTRTHCPYCRYQKCLRVGMIKNVVRT 558  Ciona intestinalis
EEC13787      258 QLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKGAKYVCLA-NRDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRT 332  black-legged tick
Q04913        244 GRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAKYICLA-NKDCPVDKRRRNRCQFCRFQKCLVVGMVKEVVRT 318  African clawed frog
P49869        742 QLCAVCGDTAACQHYGVRTCEGCKGFFKRTVQKGSKYVCLA-DKNCPVDKRRRNRCQFCRFQKCLVVGMVKEVVRT 816  fruit fly
AAR28090      246 QLCLVCGDNAACQHYGVRTCEGCKGFFKRTIQKNAQYVCLQ-AKNCVVDKRRRNRCQYCRFQKCLKVGMVKEVVRR 320  Schistosoma mansoni
XP_001624292   13 EICAICLDKATGQHYGVTSCEGCKGFFKRSVQNKKDYTCRNlTKDCPIDKRHRNRCQYCRFQKCIQAGMIKEDAIP 88   starlet sea anemone
AAC80008      104 QPCSVCSDKAYVKHYGVFACEGCKGFFKRSVRNNRKYSCLG-KRHCDTDKKSRNRCQYCRFQKCVQVGMKPEAVQD 178  Tripedalia cystop...
NP_497731     266 KMCAVCNDRAVCLHYGARTCEGCKGFFKRTVQKNSKYTCAG-NKTCPIDKRYRSRCQYCRYQKCLEVGMVKEIVRH 340  nematode
ACN82378      193 GTCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLA-NKNCPVDKRRRNRCQYCRFQKCLSVGMVKEVVRT 267  zebra finch

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap