Conserved Protein Domain Family
NR_DBD_TR2_like

?
cd06967: NR_DBD_TR2_like 
DNA-binding domain of the TR2 and TR4 (human testicular receptor 2 and 4) is composed of two C4-type zinc fingers
DNA-binding domain of the TR2 and TR4 (human testicular receptor 2 and 4) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. TR2 and TR4 interact with specific DNA sites upstream of the target gene and modulate the rate of transcriptional initiation. TR4 and TR2 are orphan nuclear receptors; the physiological ligand is as yet unidentified. TR2 is abundantly expressed in the androgen-sensitive prostate. TR4 transcripts are expressed in many tissues, including central nervous system, adrenal gland, spleen, thyroid gland, and prostate. It has been shown that human TR2 binds to a wide spectrum of natural hormone response elements (HREs) with distinct affinities suggesting that TR2 may cross-talk with other gene expression regulation systems. The genes responding to TR2 or TR4 include genes that are regulated by retinoic acid receptor, vitamin D receptor, and peroxisome proliferator-activated receptor. TR4/2 binds to HREs as dimers. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, TR2-like receptors have a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).
Statistics
?
PSSM-Id: 143525
View PSSM: cd06967
Aligned: 12 rows
Threshold Bit Score: 188.048
Threshold Setting Gi: 118344438
Created: 24-Nov-2008
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
zinc bindingputative DNA
Feature 1:zinc binding site [ion binding site]
Evidence:
  • Comment:Zinc finger, C4-type: The domain contains two groups of four Cys residues. Each group is involved in the co-ordination of a single zinc atom.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1             #  #             #  #               #     #         #  #                   
NP_001084198 147 QLVELCVVCGDKASGRHYGAVTCEGCKGFFKRSIRKNLVYTCRGSKDCVINKHYRNRCQYCRLQRCMSLGMKQDSVQCER 226 African clawed ...
Q9N4B8       147 NCGELCVVCGDKASGRHYGAVSCEGCKGFFKRSIRKRIGYVCRSQKDCPVTKFHRNRCQYCRLRKCLSMGMRSESVQAER 226 nematode
Q26622        82 RPIELCAVCGDKASGRHYGAISCEGCKGFFKRSIRKHLGYTCRGNKDCQIIKHNRNRCQYCRLQKCLDMGMKSDSVQCER 161 purple urchin
NP_989455     68 KVFDLCVVCGDKASGRHYGAVTCEGCKGFFKRSIRKNLVYSCRGTKDCVINKHHRNRCQYCRLQRCIAFGMKQDSVQCER 147 chicken
NP_001072044 201 LTYDLCVVCGDRASGRHYGAKSCEGCKGFFKRSVRKKLTYTCRGSRDCSVNKTHRNRCQYCRFQKCVLMGMKSDSVQCER 280 Ciona intestinalis
NP_001116766 142 QPIEYCVVCGDKASGRHYGAVSCEGCKGFFKRSVRKSLTYSCRSNQDCVINKHHRNRCQFCRLRKCLEMGMKMESVQSER 221 zebrafish
Q505F1        96 KVFDLCVVCGDKASGRHYGAITCEGCKGFFKRSIRKNLVYSCRGSKDCVINKHHRNRCQYCRLQRCIAFGMKQDSVQCER 175 house mouse
AAC46927      47 LSVELCLVCGDRASGRHYGAISCEGCKGFFKRSIRKQLGYQCRGAMNCEVTKHHRNRCQFCRLQKCLASGMRSDSVQHER 126 fruit fly
NP_003289    131 QVVEYCVVCGDKASGRHYGAVSCEGCKGFFKRSVRKNLTYSCRSNQDCIINKHHRNRCQFCRLKKCLEMGMKMESVQSER 210 human
CAI20776     108 PPVEYCVVCGDKASGRHYGAVSCEGCKGFFKRSIRKNLVYTCRGSGECVINKHHRNRCQYCRLQRCMALGMKQDSVQCER 187 zebrafish
XP_414462     41 QVVEYCVVCGDKASGRHYGAVSCEGCKGFFKRSVRKNLTYSCRSNQDCIINKHHRNRCQFCRLKKCLEMGMKMESVQSER 120 chicken
AAM46150      17 KPQELCVVCGDKASGRHYGAISCEGCKGFFKRSIRKNLGYVCRSSKECPINKHHRNRCQYCRLQKCLSVGMRSESVQCER 96  Florida lancelet
Feature 1               
NP_001084198 227 KPIEVSR 233 African clawed frog
Q9N4B8       227 RPVNNSS 233 nematode
Q26622       162 SPLKTRD 168 purple urchin
NP_989455    148 KPIEVSR 154 chicken
NP_001072044 281 SPMHKQD 287 Ciona intestinalis
NP_001116766 222 KPIDLPR 228 zebrafish
Q505F1       176 KPIEVSR 182 house mouse
AAC46927     127 KPIVDRK 133 fruit fly
NP_003289    211 KPFDVQR 217 human
CAI20776     188 KPVEVSR 194 zebrafish
XP_414462    121 KPFDVQR 127 chicken
AAM46150      97 KPLDPTA 103 Florida lancelet

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap