Conserved Protein Domain Family
NR_DBD_CAR

?
cd06966: NR_DBD_CAR 
DNA-binding domain of constitutive androstane receptor (CAR) is composed of two C4-type zinc fingers
DNA-binding domain (DBD) of constitutive androstane receptor (CAR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. CAR DBD interacts with CAR response element, a perfect repeat of two AGTTCA motifs with a 4 bp spacer upstream of the target gene, and modulates the rate of transcriptional initiation. The constitutive androstane receptor (CAR) is a ligand-regulated transcription factor that responds to a diverse array of chemically distinct ligands, including many endogenous compounds and clinical drugs. It functions as a heterodimer with RXR. The CAR/RXR heterodimer binds many common response elements in the promoter regions of a diverse set of target genes involved in the metabolism, transport, and ultimately, elimination of these molecules from the body. CAR is a closest mammalian relative of PXR and is activated by some of the same ligands as PXR and regulates a subset of common genes. The sequence homology and functional similarity suggests that the CAR gene arose from a duplication of an ancestral PXR gene. Like other nuclear receptors, CAR has a central well conserved DNA binding domain, a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain.
Statistics
?
PSSM-Id: 143524
View PSSM: cd06966
Aligned: 10 rows
Threshold Bit Score: 179.178
Threshold Setting Gi: 170583465
Created: 24-Nov-2008
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
zinc bindingputative DNA
Feature 1:zinc binding site [ion binding site]
Evidence:
  • Comment:Zinc finger, C4-type: The domain contains two groups of four Cys residues. Each group is involved in the coordination of a single zinc atom
  • Comment:contacts defiend by comparison to related proteins

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1          #  #             #  #               #     #         #  #                      
NP_001041239  82 KTCRVCGDHATGYNFNVITCESCKAFFRRNALRPKEFKCPYSEDCEINSVSRRFCQKCRLRKCFTVGMKKEWILNEEQLR 161 nematode
Q24143         5 KNCAVCGDKALGYNFNAVTCESCKAFFRRNALAKKQFTCPFNQNCDITVVTRRFCQKCRLRKCLDIGMKSENIMSEEDKL 84  fruit fly
NP_741445     24 RICTVCSDRANGYNFGVLTCESCKAFFRRNASKHKEIKCPFSDSCQITSASRKFCQACRLNKCFAVGMNSEWLNDLKPKS 103 nematode
CAO79101      34 KICSVCGDKALGYNFNAMTCESCKAFFRRNALSTKGFTCPFSESCEITVVTRRFCQKCRLDKCFQIGMKKEYIMSEEDKA 113 yellow fever mo...
XP_001606458  12 KICGVCGDRALGYNFNAVSCESCKAFFRRNALKNKDFRCPFSENCSITPVTRRFCQKCRLDKCFSIGMRKEYIMSEEDKV 91  jewel wasp
XP_968487      8 KVCGVCGDKALGYNFNAVTCESCKAFFRRNALVQKQFKCPFNDQCEITTITRRFCQKCRLDKCFAIGMCKDLIMSEEDKH 87  red flour beetle
EEB17317      45 KICKVCGDKALGYNFNAITCESCKAFFRRNALKNKEFKCPFNKKCIINPVTRRFCQLCRLIKCFEIGMRKEYIMSEDDKL 124 human body louse
EEC11854      11 KFCGVCGDKAFGYNFGALTCESCKAFFRRNAIKNKEFRCLFKDDCEVNTRTRRFCQRCRLQKCFSIGMKKECILSEAEKQ 90  black-legged tick
NP_001024999  98 KVCRVCGDKAFSYNFNVITCESCKAFFRRNANKEKEIRCPFNEQCEINMVSRRFCQRCRLTKCFAVGMKKEWIMSEEARL 177 nematode
XP_001896592  26 KSCKVCGDRAIGYNFSVITCESCKAFFRRNANRQESLKCPFNQKCVINVLKRRFCQSCRLQRCFQVGMKKEWIMREGYRS 105 agent of lympha...
Feature 1                      
NP_001041239 162 RRKNSRLNNTGTCN 175 nematode
Q24143        85 IKRRKIETNRAKRR 98  fruit fly
NP_741445    104 SIVSGKFKRKKPDM 117 nematode
CAO79101     114 LKRKKIEQNRAKKQ 127 yellow fever mosquito
XP_001606458  92 LKRQKIEQNRAKKR 105 jewel wasp
XP_968487     88 LKRQKIEENRARKR 101 red flour beetle
EEB17317     125 EKRKKIEKNRAIKR 138 human body louse
EEC11854      91 EKRAKIEENRLKRA 104 black-legged tick
NP_001024999 178 EKKQRVEENRERRL 191 nematode
XP_001896592 106 RKHRLSTIPENDEE 119 agent of lymphatic filariasis

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap