2NLL


Conserved Protein Domain Family
NR_DBD_TR

?
cd06961: NR_DBD_TR 
Click on image for an interactive view with Cn3D
DNA-binding domain of thyroid hormone receptors (TRs) is composed of two C4-type zinc fingers
DNA-binding domain of thyroid hormone receptors (TRs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. TR interacts with the thyroid response element, which is a DNA site with direct repeats of the consensus sequence 5'-AGGTCA-3' separated by one to five base pairs, upstream of target genes and modulates the rate of transcriptional initiation. Thyroid hormone receptor (TR) mediates the actions of thyroid hormones, which play critical roles in growth, development, and homeostasis in mammals. They regulate overall metabolic rate, cholesterol and triglyceride levels, and heart rate, and affect mood. TRs are expressed from two separate genes (alpha and beta) in human and each gene generates two isoforms of the receptor through differential promoter usage or splicing. TRalpha functions in the heart to regulate heart rate and rhythm and TRbeta is active in the liver and other tissues. The unliganded TRs function as transcription repressors, by binding to thyroid hormone response elements (TRE) predominantly as homodimers, or as heterodimers with retinoid X-receptors (RXR), and being associated with a complex of proteins containing corepressor proteins. Ligand binding promotes corepressor dissociation and binding of a coactivator to activate transcription. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, TR has a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).
Statistics
?
PSSM-Id: 143519
View PSSM: cd06961
Aligned: 15 rows
Threshold Bit Score: 144.481
Threshold Setting Gi: 1942117
Created: 21-Nov-2008
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 8 residues -Click on image for an interactive view with Cn3D
Feature 1:zinc binding site [ion binding site]
Evidence:
  • Structure:2NLL_B; zinc binding site of human Thyroid Hormone Receptor DNA binding domain, contacts determined at 4A
    View structure with Cn3D
  • Comment:Zinc finger, C4-type: The domain contains two groups of four Cys residues. Each group is involved in the co-ordination of a single zinc atom.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1          #  #             #  #                 #      #         #  #                    
2NLL_B          3 LCVVCGDKATGYHYRCITCEGCKGFFRRTIQKNLhpSYSCKYEG-KCVIDKVTRNQCQECRFKKCIYVGMATDLVLDDSK 81   human
XP_001185977   76 PCVVCGDAATGYHYRCMTCEGCKGFFRRTIQKKL--SYYCKWNE-ECIIDKTTRNQCQQCRYKKCLNVGMAPDLVLNESQ 152  purple urchin
Q25604         34 PCVVCGDDATGLHYRAITCEGCKGFFRRTVQQKI--VYKCKSIE-RCEISKISRNICQFCRFQKCLRNGMTKSLVLNETE 110  Onchocerca vo...
BAE06733       43 ECVVCGDKATGYHYRCITCEGCKGFFRRTVQKDLqkTYQCKQRG-KCQVNKVSRNQCQMCRYEKCIATGMATDLVLNEDK 121  Ciona intesti...
AAR32912      201 PCVVCGDNATGFHYRAMTCEGCKGFFRRSVQKKL--VYTCKYNGrCSVSDKQNRNSCQKCRFDRCIKGGMAKDLVLDEEK 278  Schistosoma m...
BAB68358       44 VCVVCGDKATGYHYRCITCEGCKGFFRRTVQKGLhqAYQCKQDE-KCQINKVSRNQCQLCRYKKCITTGMATDLVLNEDK 122  Ciona savignyi
ABC49722       16 PCVVCGDKATGYHYRCITCEGCKGFFRRTIQKKLhpSYACKFGG-RCAVDRVTRNQCQECRFRKCLAAGMAADLVLDESK 94   sea lamprey
ABS11249       53 PCVVCGDKATGYHYRCMTCEGCKGFFRRTVQKDL--KYSCKYAG-DCVVDKTTRNQCQECRFKKCVRVGMATDLVLDEQK 129  Florida lancelet
XP_002221210 1668 FCLICNDRASGYHYSVYSCEGCKGFFKRTVQKNL--SYKCKGEG-HCEINKFTRNNCQSCRFQKCMDNGMKKEAVREDRA 1744 Florida lancelet
AAL29194       85 ECVVCNDKATGYHYGVFTCEGCKGFFKRTVQKQL--EYTCKGDG-NCEVNQISRNRCQYCRFNKCLAQGMLKEAVREDRT 161  Acropora mill...
Feature 1                 
2NLL_B         82 RLAKRKLI 89   human
XP_001185977  153 RKAKRALI 160  purple urchin
Q25604        111 RIAKRKMI 118  Onchocerca volvulus
BAE06733      122 RIAKRKLI 129  Ciona intestinalis
AAR32912      279 RLAKRRLI 286  Schistosoma mansoni
BAB68358      123 RLAKRRLI 130  Ciona savignyi
ABC49722       95 RQAKRRLI 102  sea lamprey
ABS11249      130 RVAKRKLI 137  Florida lancelet
XP_002221210 1745 PGGRQGQK 1752 Florida lancelet
AAL29194      162 PGGRHRHR 169  Acropora millepora

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap