2EBL


Conserved Protein Domain Family
NR_DBD_COUP_TF

?
cd06958: NR_DBD_COUP_TF 
Click on image for an interactive view with Cn3D
DNA-binding domain of chicken ovalbumin upstream promoter transcription factors (COUP-TFs) is composed of two C4-type zinc fingers
DNA-binding domain of chicken ovalbumin upstream promoter transcription factors (COUP-TFs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. COUP-TFs are orphan members of the steroid/thyroid hormone receptor superfamily. They are expressed in many tissues and are involved in the regulation of several important biological processes, such as neurogenesis, organogenesis, cell fate determination, and metabolic homeostasis. COUP-TFs homodimerize or heterodimerize with retinoid X receptor (RXR) and a few other nuclear receptors and bind to a variety of response elements that are composed of imperfect AGGTCA direct or inverted repeats with various spacings. COUP-TFs are generally considered to be repressors of transcription for other nuclear hormone receptors such as retinoic acid receptor (RAR), thyroid hormone receptor (TR), vitamin D receptor (VDR), peroxisome proliferator activated receptor (PPAR), and hepatocyte nuclear factor 4 (HNF4). Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, COUP-TFs have a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).
Statistics
?
PSSM-Id: 143516
View PSSM: cd06958
Aligned: 17 rows
Threshold Bit Score: 130.35
Threshold Setting Gi: 168176980
Created: 24-Nov-2008
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
zinc bindingputative DNA
Conserved site includes 8 residues -Click on image for an interactive view with Cn3D
Feature 1:zinc binding site [ion binding site]
Evidence:
  • Structure:2EBL_A; zinc binding site of Human Coup Transcription Factor 1.
    View structure with Cn3D
  • Comment:Zinc finger, C4-type: The domain contains two groups of four Cys residues. Each group is involved in the co-ordination of a single zinc atom.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1         #  #             #  #               #     #         #  #                 
2EBL_A         10 CVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQR 82   human
NP_731681     200 CVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYSCRGSRNCPIDQHHRNQCQYCRLKKCLKMGMRREAVQR 272  fruit fly
NP_001071673   79 CVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLSYTCRGNRNCPIDQHHRNQCQYCRLNKCVKIGMRREAVQR 151  Ciona intestinalis
AAA30041      141 CVVCHDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYSCRANRNCPIDQHHRNQCQYCRLKKCLKMGMRREAVQR 213  purple urchin
AAL29200       30 CAVCGDKSSGKHYGVFTCEGCKSFFKRSVRRNLSYTCRASRNCPIDQHHRNQCQYCRLRKCMKVGMRREAVQR 102  Acropora millepora
XP_001898597  188 CVVCGDKSSGKHYGQFSCEGCKSFFKRSIRRSLNYTCRGSKNCPVDVNHRNQCQYCRLKKCERMGMRKEAVQR 260  agent of lymphatic f...
XP_001634340   32 CAVCGDKSSGKHYGVYTCEGCKSFFKRSIRRSLSYSCRGVRNCPVDIQNRNQCQYCRLKKCLKVGMRKEAVQK 104  starlet sea anemone
XP_002031503  200 CVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYSCGGSRNCPIDQHHRNQCQYCRLKKVPQNGHETRSTCP 272  Drosophila sechellia
CAG00925       54 CMVCGDRSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRGNRDCPIDQHHRNQCQYCRLKKVPQSRDEERRSES 126  spotted green puffer...
EEC00888       47 CVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRGNRNCPIDQHHRNQCQYCRLKKCLKMGMRREVVFG 119  black-legged tick

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap