Conserved Protein Domain Family
NR_DBD_PNR_like_2

?
cd06957: NR_DBD_PNR_like_2 
DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like is composed of two C4-type zinc fingers
The DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) nuclear receptor-like family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. PNR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. This family includes nuclear receptor Tailless (TLX), photoreceptor cell-specific nuclear receptor (PNR) and related receptors. TLX is an orphan receptor that plays a key role in neural development by regulating cell cycle progression and exit of neural stem cells in the developing brain. PNR is expressed only in the outer layer of retinal photoreceptor cells. It may be involved in the signaling pathway regulating photoreceptor differentiation and/or maintenance. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, PNR-like receptors have a central well-conserved DNA-binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).
Statistics
?
PSSM-Id: 143515
View PSSM: cd06957
Aligned: 9 rows
Threshold Bit Score: 154.543
Threshold Setting Gi: 115534108
Created: 2-Feb-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
zinc bindingputative DNA
Feature 1:zinc binding site [ion binding site]
Evidence:
  • Comment:Zinc finger, C4-type: The domain contains two groups of four Cys residues. Each group is involved in the co-ordination of a single zinc atom.
  • Comment:coordination residues based on related proteins

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1         #  #             #  #               #      #         #  #                       
XP_001607668   11 CKVCGDRSYGKHYGVYCCDGCSCFFKRSIRRGVLYTCIaGNGSCVIDKARRNWCPHCRLKKCFAVSMNTAAVQEERGPRS 90   jewel wasp
XP_795547      11 CKVCGDKSYGKHYGVYCCDGCSCFFKRSIRRNMRYTCI-GKGNCLVDKARRNWCPYCRLKKCFAVNMNKSAVQEERGPRK 89   purple urchin
XP_001121181   11 CKVCGDRSYGKHYGVYCCDGCSCFFKRSVRRGALFTCIaGIGACFVDKARRNWCPYCRLKKCFTVGMNTAAVQEERGPRV 90   honey bee
CAO79102        7 CKVCGDRSSGKHYGSICCDGCSCFFKRSIRKRAFYTCIsGQGGCSVDKARRNWCPFCRLQKCFLVGMNAAAVQEERGPRI 86   yellow fever ...
NP_649647       7 CAVCGDQSSGKHYGVSCCDGCSCFFKRSVRRGSSYACIaLVGNCVVDKARRNWCPSCRFQRCLAVGMNAAAVQEERGPRN 86   fruit fly
XP_001359246    7 CEVCGDQSSGKHYGVSCCDGCSCFFKRSVRKGNHYACIaIKGNCIVDKARRNWCPFCRFQRCLAVGMNVAAVQDERGPRN 86   Drosophila ps...
XP_002072851   18 CQVCGDQSSGKHYGVYCCDGCSCFFKRSVRKGNHYVCIaIKGNCIVDKARRNWCPFCRFQRCLAVGMNISAVQEERGPRS 97   Drosophila wi...
NP_497579      40 CEICGDKSYGRHYGVWACDGCSCFFKRSVRKNIIYTCIaGNWKCVVDKGRRNWCPACRLAKCTRLKMNRLAVQTERGPRR 119  nematode
XP_001665139   11 CEICGDKSYGRHYGVWACDGCSCFFKRSVRKNIIYTCIaGNWRCVVDKGRRNWCPACRLAKCTKLNMNRLAVQNERGPRK 90   Caenorhabditi...
Feature 1           
XP_001607668   91 RS 92   jewel wasp
XP_795547      90 KK 91   purple urchin
XP_001121181   91 RT 92   honey bee
CAO79102       87 TE 88   yellow fever mosquito
NP_649647      87 QQ 88   fruit fly
XP_001359246   87 QQ 88   Drosophila pseudoobscura pseudoobscura
XP_002072851   98 TS 99   Drosophila willistoni
NP_497579     120 LR 121  nematode
XP_001665139   91 LR 92   Caenorhabditis briggsae AF16

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap