1UPV,1P8D,3FC6,1UHL


Conserved Protein Domain Family
NR_LBD_LXR

?
cd06954: NR_LBD_LXR 
Click on image for an interactive view with Cn3D
The ligand binding domain of Liver X receptors, a family of nuclear receptors of ligand-activated transcription factors.
The ligand binding domain of Liver X receptors: Liver X receptors (LXRs) belong to a family of nuclear receptors of ligand-activated transcription factors. LXRs operate as cholesterol sensors which protect from cholesterol overload by stimulating reverse cholesterol transport from peripheral tissues to the liver and its excretion in the bile. Oxidized cholesterol derivatives or oxysterols were identified as specific ligands for LXRs. Upon ligand binding a conformational change leads to recruitment of co-factors, which stimulates expression of target genes. Among the LXR target genes are several genes involved in cholesterol efflux from peripheral tissues such as the ATP-binding-cassette transporters ABCA1, ABCG1 and ApoE. There are two LXR isoforms in mammals, LXRalpha and LXRbeta. LXRalpha is expressed mainly in the liver, intestine, kidney, spleen, and adipose tissue, whereas LXRbeta is ubiquitously expressed at lower level. Both LXRalpha and LXRbeta function as heterodimers with the retinoid X receptor (RX R) which may be activated by either LXR ligands or 9-cis retinoic acid, a specific RXR ligand. The LXR/RXR complex binds to a liver X receptor response element (LXRE) in the promoter region of target genes. LXR has typical NR modular structure with a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and the ligand binding domain (LBD) at the C-terminal.
Statistics
?
PSSM-Id: 132752
View PSSM: cd06954
Aligned: 10 rows
Threshold Bit Score: 379.866
Threshold Setting Gi: 193788681
Created: 5-Dec-2008
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 19 residues -Click on image for an interactive view with Cn3D
Feature 1:ligand binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                        
1UPV_A        20 QELMIQQLVAAQLqcnKRSFSDQPKVTPWPlgadpq-------------------------------------------- 55  human
NP_001123279 207 QREVIENLVSIHKeleIPGPEDLKRVTPWKegqnsgqdssddngpksvqasdiydtsnplpglmpvsltpkrsedgdgee 286 purple urchin
NP_001086083 204 QEKMIEQLVSAQQqcnKRSFSDQPKVTPWPpgtdpn-------------------------------------------- 239 African clawed ...
NP_001017545 175 QQEMIEKLVAMQKqcnKRSFIDRPKVTPWPqsqdpq-------------------------------------------- 210 zebrafish
NP_989873    172 QLNMIEKLVAAQQqcnQRSFTDRLKVTPWPqvpdpn-------------------------------------------- 207 chicken
EEA62543     128 QTEIVEQLLKAQRevlHPSKEDVEKVTPWPndsdq--------------------------------------------- 162 Florida lancelet
Q4H386       324 QRNLVEILQANEArfqWPTQEAVAKVTPWVesgds--------------------------------------------- 358 Ciona intestinalis
1P8D_A        13 QELMIQQLVAAQLqcnKRSFSDQPKVTPWPlgadpq-------------------------------------------- 48  human
3FC6_B        29 QLGMIEKLVAAQQqcnRRSFSDRLRVTPWPiapdpq-------------------------------------------- 64  house mouse
1UHL_B         5 QLGMIEKLVAAQQqcnRRSFSDRLRVTPWPmapdph-------------------------------------------- 40  human
Feature 1                    #  ## ##                                 #  ##  #          #        
1UPV_A        56 ----srdarQQRFAHFTELAIISVQEIVDFAKQVPGFLqLGREDQIALLKASTIEIMLLETARRYNheteCITFLKDFTY 131 human
NP_001123279 287 lddqdndalHRRFAHITELTILTIQLIVEYSKHIPGFLtLTREDQILLLKGSAIEVIMLRVALRYDreldAIMFGNEMPY 366 purple urchin
NP_001086083 240 ----srearQQRFAHFTELAIISVQEIVDFAKQVPGFLeLSREDQIALLKASTIEIMLLETARRYNheteCITFLKDFTY 315 African clawed ...
NP_001017545 211 ----nrevrQQRFAHFTELAIMSVQEIVDFAKQLPGFLeLTREDQIALLKTSTIEIMLLETSRRYNpaidSITFLKDFTY 286 zebrafish
NP_989873    208 ----nrearQQRFAHFTELAIISVQEIVDFAKQLPGFReLTREDQIALLKTSTIEVMLLETSRRYNpeieSITFLKDLSY 283 chicken
EEA62543     163 ----skeaaEARFSHFTDLTILGVQAIVEFSKRIPGFLrLTREDQIVLLKSSAIEILVLDVARRYDekmdMLYFWNGLPY 238 Florida lancelet
Q4H386       359 -----hrcrASRFAHFTELAILIVQLVVEFTKQLPGFLtVSREDQILLLKACTIEVMLLRAAKQYDkkskAINFLNGKFY 433 Ciona intestinalis
1P8D_A        49 ----srdarQQRFAHFTELAIISVQEIVDFAKQVPGFLqLGREDQIALLKASTIEIMLLETARRYNheteCITFLKDFTY 124 human
3FC6_B        65 ----srearQQRFAHFTELAIVSVQEIVDFAKQLPGFLqLSREDQIALLKTSAIEVMLLETSRRYNpgseSITFLKDFSY 140 house mouse
1UHL_B        41 ----srearQQRFAHFTELAIVSVQEIVDFAKQLPGFLqLSREDQIALLKTSAIEVMLLETSRRYNpgseSITFLKDFSY 116 human
Feature 1                     #   #                                                              
1UPV_A       132 skddfhraglqvEFINPIFEFSRAMrrLGLDDAEYALLIAINIFSADRPnVQEPGRVEALQQPYVEALLSYTRIKRPqdq 211 human
NP_001123279 367 trkqll-eggigDLVDPMYNFAKSMseLDLDYAEFILLMAITILSPDRPaINERERVEQMQETYLDMLRSYLKLRRPhev 445 purple urchin
NP_001086083 316 skddfhraglqvEFINPIFEFSRGMrqMQLDDAEYALLIAINIFSADRPnVLNHQHVENLQLPYVEALHSYTRIKRPqdh 395 African clawed ...
NP_001017545 287 nkedfakaglqlEFINPIFEFSKGMndLHLDEAEYALLIAINIFSADRPnVQDHELVERLQQPYVDALHSYIRIKRPndh 366 zebrafish
NP_989873    284 nrddfakaglqfEFINPIFEFSKGMneLQLNDAEYALLIAINIFSADRPnVQDQSLVERLQHTYVEALHSYICINRPndh 363 chicken
EEA62543     239 srhnfk-hagltELVNPMYDFSKRIrnVHIDDTAYAILASIIVLSPDRAdVSDHHTVEKMQEVFLETLQAYIKTTMPsdr 317 Florida lancelet
Q4H386       434 dkssfyragmqvEFVDPIFDFCNSMaqLGLNEAEYALLVAINTFSADRPnIKDMHKVEAVQNSYVELLRVYLKIHHPsdp 513 Ciona intestinalis
1P8D_A       125 skddfhraglqvEFINPIFEFSRAMrrLGLDDAEYALLIAINIFSADRPnVQEPGRVEALQQPYVEALLSYTRIKRPqdq 204 human
3FC6_B       141 nredfakaglqvEFINPIFEFSRAMneLQLNDAEFALLIAISIFSADRPnVQDQLQVERLQHTYVEALHAYVSINHPhdp 220 house mouse
1UHL_B       117 nredfakaglqvEFINPIFEFSRAMneLQLNDAEFALLIAISIFSADRPnVQDQLQVERLQHTYVEALHAYVSIHHPhdr 196 human
Feature 1                           #  ##  #      #   #   #  
1UPV_A       212 LRFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDV 255 human
NP_001123279 446 LLLPKVLMKLTELRSLNNSHSELLFQLKVKDQKIPPLLQEIWDV 489 purple urchin
NP_001086083 396 LMFPRMLMKLVSLRTLSSVHSEQFFALRLQDKKLPPLLSEIWDV 439 African clawed frog
NP_001017545 367 LMFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDV 410 zebrafish
NP_989873    364 LMFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDV 407 chicken
EEA62543     318 LLLPRILMKLTDLRAINNTHCEQLLALKVENHKIPPLLSEIWDV 361 Florida lancelet
Q4H386       514 LMFPRTLMKLVELRTLNNYHSEQIFALKVQDKQLPPLLAEIWDM 557 Ciona intestinalis
1P8D_A       205 LRFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDV 248 human
3FC6_B       221 LMFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDV 264 house mouse
1UHL_B       197 LMFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDV 240 human

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap