2AX9,2AA6,1SR7,1NHZ,3CLD,1M2Z,1XJ7,1T73,1T5Z,1XOW,2Q7K,1SQN,1E3K,1A28,2AA2,2A3I,2OAX,1Y9R,2ABI,3BQD


Conserved Protein Domain Family
NR_LBD_GR_Like

?
cd06947: NR_LBD_GR_Like 
Click on image for an interactive view with Cn3D
Ligand binding domain of nuclear hormone receptors:glucocorticoid receptor, mineralocorticoid receptor , progesterone receptor, and androgen receptor
The ligand binding domain of GR_like nuclear receptors: This family of NRs includes four distinct, but closely related nuclear hormone receptors: glucocorticoid receptor (GR), mineralocorticoid receptor (MR), progesterone receptor (PR), and androgen receptor (AR). These four receptors play key roles in some of the most fundamental physiological functions such as the stress response, metabolism, electrolyte homeostasis, immune function, growth, development, and reproduction. The NRs in this family use multiple signaling pathways and share similar functional mechanisms. The dominant signaling pathway is via direct DNA binding and transcriptional regulation of target genes. Another mechanism is via protein-protein interactions, mainly with other transcription factors such as nuclear factor-kappaB and activator protein-1, to regulate gene expression patterns. Both pathways can up-regulate or down-regulate gene expression and require ligand activation of the receptor and recruitment of other cofactors such as chaperone proteins and coregulator proteins. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, GR, MR, PR, and AR share the same modular structure with a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).
Statistics
?
PSSM-Id: 132745
View PSSM: cd06947
Aligned: 35 rows
Threshold Bit Score: 466.068
Threshold Setting Gi: 169146179
Created: 19-Nov-2008
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 21 residues -Click on image for an interactive view with Cn3D
Feature 1:ligand binding site [chemical binding site]
Evidence:
  • Structure:1NHZ_a; human Glucocorticoid receptor binds to antagonist RU-486, contacts at 4A
    View structure with Cn3D
  • Structure:3CLD_a; human glucocoticoid receptor binds to agonist fluticasone furoate, contacts at 4A
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                  #  ## ##  #                             ##  ##  #  
2AX9_A      9 IFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGW 88  human
1SR7_A     12 PLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGW 91  human
1NHZ_A     34 TLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMSLMAFALGW 113 human
Q7T1K4    530 IFLNVLEAIEPMVVCSGHDNNQPDSFALLLSSLNELGERQLVHVVKWAKALPGFRNLHVNDQMTVIQYSWMGLMIFAMGW 609 bullfrog
Q8JH77     86 IFLNVLEAIEPGVVCAGHDNSQPDSFSNLLSSLNELGERQLVYVVKWAKALPGFRNLHVDDQMSIIQYSWMGLMVFAMGW 165 Taeniopygia guttata
Q9YGV9    602 MFLNILEAIEPEVVNAGHDYGQPDSAASLLTSLNELGERQLVKVVKWAKGMPGFRSLYVDDQMTVIQHSWMAVMVFALGW 681 Japanese eel
P07812    539 PMISVLRGIEPEVVYAGYDNTKPETPSSLLTSLNHLCERQLLCVVKWSKLLPGFRNLHIDDQITLIQYSWMSLMVFAMGW 618 chicken
Q8UVY3    456 ELLQILQSIEPEVVYAGYDNTQPETPSALLSSLNQLCERQLVCVVKWSKSLPGFRNLHIDDQITLLQYSWMSLMVFALGW 535 African clawed frog
1SQN_A     14 PLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGW 93  human
1E3K_A     11 PLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGW 90  human
Feature 1     #           #               #   #  #                                            
2AX9_A     89 RSFTNVNSRMLYFAPDLVFNEYRMHKSRMYsqCVRMRHLSQEFgwLQITPQEFLCMKALLLFSIIPVDGLKnQKFFDELR 168 human
1SR7_A     92 RSYKHVSGQMLYFAPDLILNEQRMKESSFYslCLTMWQIPQEFvkLQVSQEEFLCMKVLLLLNTIPLEGLRsQTQFEEMR 171 human
1NHZ_A    114 RSYRQSSANLLCFAPDLIINEQRMTLPDMYdqCKHMLYVSSELhrLQVSYEEYLCMKTLLLLSSVPKDGLKsQELFDEIR 193 human
Q7T1K4    610 RSFKNVNSRMLYFAPDLVFNEYRMHKSRMYsqCVRMRHLSQEFgwLQVTPEEFLCDEGPSALSIIPVEGLKdQKCFDELR 689 bullfrog
Q8JH77    166 RSFTNVNSRMLYFAPDLVFNEYRMHKSRMYsqCIRMRHLSQEFgwLQITPQEFLCMKALLFFSIIPVDGLKnQKLFDELR 245 Taeniopygia guttata
Q9YGV9    682 RSFKNVKSRMLYFAPDLVFNEHRMQVSTMYehCIRMKNFSQEFamLQVSQEEFLCMKALLLFSTIPVEGLKgQNFFDELR 761 Japanese eel
P07812    619 RSYKHVSGQMLYFAPDLILNEQRMKESSFYslCLSMWQLPQEFvrLQVSQEEFLCMKALLLLNTIPLEGLRsQSQFDEMR 698 chicken
Q8UVY3    536 RSYQHVSGQMLYFAPDLILNEQRMKDSSFYtlCLSMWQLPQEFmkLQVTHEEFLCMKALLLLNTIPLEGLKsQTNFDEMR 615 African clawed frog
1SQN_A     94 RSYKHVSGQMLYFAPDLILNEQRMKESSFYslCLTMWQIPQEFvkLQVSQEEFLCMKVLLLLNTIPLEGLRsQTQFEEMR 173 human
1E3K_A     91 RSYKHVSGQMLYFAPDLILNEQRMKESSFYslCLTMWQIPQEFvkLQVSQEEFLCMKVLLLLNTIPLEGLRsQTQFEEMR 170 human
Feature 1                                              #  ##  #            #                  
2AX9_A    169 MNYIKELDRIIackrknptscSRRFYQLTKLLDSVQPIARELHQFTFDLLiks--hmvSVDFPEMMAEIISVQVPKILSG 246 human
1SR7_A    172 SSYIRELIKAIglrqkgvvssSQRFYQLTKLLDNLHDLVKQLHLYCLNTFiqs--ralSVEFPEMMSEVIAAQLPKILAG 249 human
1NHZ_A    194 MTYIKELGKAIvkregnssqnWQRFYQLTKLLDSMHEVVENLLNYCFQTFldk---tmSIEFPEMLAEIITNQIPKYSNG 270 human
Q7T1K4    690 MNYIKELDRVIsckrnnpassSPRFFNLPKLLGSVQPIDVNLVQFTFGLFgka--qmvSVDFPEMMSEIISVQVPKILSG 767 bullfrog
Q8JH77    246 MNYIKELDRIIackrknptscSRRFYQLTKVLDSVHPIAKDLHQFTFDLLika--hmvSVDYPEMMAEIISVQVPKILSG 323 Taeniopygia guttata
Q9YGV9    762 RSYINELDRLVsfrs--ksscSERFQQLTRLLDSLQPVLKKLHQFTFDLFvqsqnlsnQVCFPEMISEIISVHVPKILAG 839 Japanese eel
P07812    699 TSYIRELVKAIglrqkgvvanSQRFYQLTKLMDSMHDLVKQLHLFCLNTFlqs--ralSVEFPEMMSEVIAAQLPKILAG 776 chicken
Q8UVY3    616 SNYIRELAKAIslrhkgviasSQRFYQLTKLMDSMHELVKQLHLYCLNTFlqs--rslSVEFPEMMSEVISAQLPKILAG 693 African clawed frog
1SQN_A    174 SSYIRELIKAIglrqkgvvssSQRFYQLTKLLDNLHDLVKQLHLYCLNTFiqs--ralSVEFPEMMSEVIAAQLPKILAG 251 human
1E3K_A    171 SSYIRELIKAIglrqkgvvssSQRFYQLTKLLDNLHDLVKQLHLYCLNTFiqs--ralSVEFPEMMSEVIAAQLPKILAG 248 human
Feature 1             
2AX9_A    247 KVKPIYFH 254 human
1SR7_A    250 MVKPLLFH 257 human
1NHZ_A    271 NIKKLLFH 278 human
Q7T1K4    768 RVKPLYFH 775 bullfrog
Q8JH77    324 KVKPIYFH 331 Taeniopygia guttata
Q9YGV9    840 TVKPILFH 847 Japanese eel
P07812    777 MVKPLLFH 784 chicken
Q8UVY3    694 MVKPLVFH 701 African clawed frog
1SQN_A    252 MVKPLLFH 259 human
1E3K_A    249 MVKPLLFH 256 human

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap