1OVL,1PDU,1YJE,1OVL


Conserved Protein Domain Family
NR_LBD_Nurr1_like

?
cd06945: NR_LBD_Nurr1_like 
Click on image for an interactive view with Cn3D
The ligand binding domain of Nurr1 and related nuclear receptor proteins, members of nuclear receptor superfamily
The ligand binding domain of nuclear receptor Nurr1_like: This family of nuclear receptors, including Nurr1, Nerve growth factor-induced-B (NGFI-B) and DHR38 are involved in the embryo development. Nurr1 is a transcription factor that is expressed in the embryonic ventral midbrain and is critical for the development of dopamine (DA) neurons. Structural studies have shown that the ligand binding pocket of Nurr1 is filled by bulky hydrophobic residues, making it unable to bind to ligands. Therefore, it belongs to the class of orphan receptors. However, Nurr1 forms heterodimers with RXR and can promote signaling via its partner, RXR. NGFI-B is an early immediate gene product of embryo development that is rapidly produced in response to a variety of cellular signals including nerve growth factor. It is involved in T-cell-mediated apoptosis, as well as neuronal differentiation and function. NGFI-B regulates transcription by binding to a specific DNA target upstream of its target genes and regulating the rate of tr anscriptional initiation. Another group of receptor in this family is DHR38. DHR38 is the Drosophila homolog to the vertebrate NGFI-B-type orphan receptor. It interacts with the USP component of the ecdysone receptor complex, suggesting that DHR38 might modulate ecdysone-triggered signals in the fly, in addition to the ECR/USP pathway. Nurr1_like proteins exhibit a modular structure that is characteristic for nuclear receptors; they have a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a non-conserved hinge and a C-terminal ligand binding domain (LBD).
Statistics
?
PSSM-Id: 132743
View PSSM: cd06945
Aligned: 10 rows
Threshold Bit Score: 271.967
Threshold Setting Gi: 74938425
Created: 19-Nov-2008
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
heterodimerputative
Conserved site includes 9 residues -Click on image for an interactive view with Cn3D
Feature 1:heterodimer interface [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                  #  #  ##                                                               
1OVL_A         34 PVSLISALVRAHVDSNPam----tSLDYSRFQanpdyqm-------------------------sgddtqHIQQFYDLLT 84   human
1PDU_A         12 AISLITALVRSHVDTTPdp----sCLDYSHYEeqsm------------------------------seadKVQQFYQLLT 57   fruit fly
1YJE_A         27 PTNLLTSLIRAHLDSGPnt----aKLDYSKFQelvlprf-------------------------gkedagDVQQFYDLLS 77   Norway rat
AAT09759      354 PLSLLNALVRAYSQSTPr------ELDYSQVTdavepv--------------------------glsesqQIQMFYRVLT 401  zebrafish
Q4RI46        388 PLSLLSALLRAYSHSTPr------DLDYSQVInfrppdlrfclgfraaaciclspqfsaadpptstpdveQIQLFYRLLT 461  Tetraodon nig...
NP_001071779  814 PVSFITSLVRAHVDTNPai----sNTDTSKYRppgiapct-----------------------pplrvvdEAINFYELLS 866  Ciona intesti...
Q95WF8        108 SSELVTQLIQARPDAIPkkrpdyvDLGFVDICpl-----------------------------------nPVEIIMDLAL 152  Acropora mill...
AAL29194      197 DCTDKSLAPRSADAPSSre---etMAFIAKIQenvtlvpeipgh---------------slesdekpgskDVNKLMALAY 258  Acropora mill...
1OVL_B         34 PVSLISALVRAHVDSNPam----tSLDYSRFQanpdyqm-------------------------sgddtqHIQQFYDLLT 84   human
XP_786266     486 PVSLITALVRAHVDASPak----aNRDYSQFRlpgdvis-------------------------pppdneQLQIFYDNFC 536  purple urchin
Feature 1                                                                                         
1OVL_A         85 GSMEIIRGWAEKIPGFaDLPKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFGEWIDSIVEFSS 164  human
1PDU_A         58 SSVDVIKQFAEKIPGYfDLLPEDQELLFQSASLELFVLRLAYRARIDDTKLIFCNGTVLHRTQCLRSFGEWLNDIMEFSR 137  fruit fly
1YJE_A         78 GSLDVIRKWAEKIPGFiELSPGDQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDNILAFSR 157  Norway rat
AAT09759      402 GSMEVTRCWAERLPGFsELHHDDQNMLIDSAFLELFVLRLANRSLLVDEKFVFCTGLVLHRLQCLRGFGEWLDSIRDFSA 481  zebrafish
Q4RI46        462 ISMETTRCWADRLPGFsELQRDDQNLLVDSAFLELFVLRLAYRSMLSEDKLVFCNGLVLHRFQCLRGFGEWLDSIRDFST 541  Tetraodon nig...
NP_001071779  867 ACQAVIRQWAEKIPGFcNLCQEDQTNLVENSFLDIFVLRLAYRSEIQEGKLVFCNGLALHRDQLYGSFGEWIDSILSFAC 946  Ciona intesti...
Q95WF8        153 QEVDLMVAWTYKVPGFkELDREDQASLLSSALLELFVLRVCQRSSPHQGSVLVAKDILLNPEHSFNMVLEQWSSQLACFS 232  Acropora mill...
AAL29194      259 TELQFVIQWAKGVPGFkDLHLEDQVCLLKACFMDLNVFRLAYRSVACDPMSVRFSQNTILEKEEVVALGWAEDLVDATLE 338  Acropora mill...
1OVL_B         85 GSXEIIRGWAEKIPGFaDLPKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFGEWIDSIVEFSS 164  human
XP_786266     537 SSIDVIRSWAERIPGFsDLCREDQDLLFQSSCLELFVLKMAYRVNPEDPYVVFCNGNVLHNQQCERGFGEWLDDIRAFSK 616  purple urchin
Feature 1                  # ###                                    #                             
1OVL_A        165 NLQn----XNIDISAFSCIAALAXVTERHGLKEPKRVEELQNKIVNCLKDHVtfnngg----lnrpnyLSKLLGKLPELR 236  human
1PDU_A        138 SLHn----LEIDISAFACLCALTLITERHGLREPKKVEQLQMKIIGSLRDHVtynaea----qkkqhyFSRLLGKLPELR 209  fruit fly
1YJE_A        158 SLHs----LGVDVPAFACLSALVLITDRHGLQDPRRVEELQNRIASCLKEHMaavagd----pqpascLSRLLGKLPELR 229  Norway rat
AAT09759      482 HLQe---lNLDMPAFSCLCALVLLTEQCPGLKEPKKVEELQSKLICCLRDHLnsinaggvastgkappPVGAVLGLRAEL 558  zebrafish
Q4RI46        542 HLQs---lNLDASAFACLAALVLLTEQVPGLKDSKRVEELQNKVICCLRDHLscgpsss---sskappPLNRVLGLRAEL 615  Tetraodon nig...
NP_001071779  947 SLAd----MNVDISSFSCLLGLLLFREPRGVREPKKVEELLGLCIESLKEHVtkssvt----adrpnyFAKLLAILPELN 1018 Ciona intesti...
Q95WF8        233 YKLqs-lqLDMAEFACVNAIMLFEQESSSGLKNREMVDFILNRSLDALRDYIkcsyp------dkpsrFAHILLRLPTLR 305  Acropora mill...
AAL29194      339 FSDklrslNLDQNEFACLSALVLLSPDTPELKNRAKVEELQAKVNSILRDYAaslyp------lkpnrLGKLLLCLPTLR 412  Acropora mill...
1OVL_B        165 NLQn----XNIDISAFSCIAALAXVTERHGLKEPKRVEELQNKIVNCLKDHVtfnngg----lnrpnyLSKLLGKLPELR 236  human
XP_786266     617 VLSs----LEIDISSFACLSSLVLITERHGLKEPEKVSQLQNRIISCLNDHVtyntca----qtranfLSRMLMQLPELR 688  purple urchin
Feature 1                                            
1OVL_A        237 TLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF 271  human
1PDU_A        210 SLSVQGLQRIFYLKLEDLVPAPALIENMFVTTLPF 244  fruit fly
1YJE_A        230 TLCTQGLQRIFCLKLEDLVPPPPIVDKIFMDTLSF 264  Norway rat
AAT09759      559 RSQRTQGLQRIXYLKLEDLVPPPPLIDRFLDTLPY 593  zebrafish
Q4RI46        616 RSQRTQGLQRIFYLKLEDLVQPPPLIDRFLDTLPY 650  Tetraodon nigroviridis
NP_001071779 1019 ALAKMGGRRIQRHSIESPGVRVPHCLQRNLSTNML 1053 Ciona intestinalis
Q95WF8        306 HVSSKMATECLFAKSFLNLAVPQVMSFVMEMKVEI 340  Acropora millepora
AAL29194      413 MFSEKALENYVTLEFFGKLDMPPLGRSSWSKLKTA 447  Acropora millepora
1OVL_B        237 TLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF 271  human
XP_786266     689 VLSKKGRQRLCALKVEGAAPVPGTIEKTYEPNLPY 723  purple urchin

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap