1NAV,1N46,1BSX,2PIN,3D57


Conserved Protein Domain Family
NR_LBD_TR

?
cd06935: NR_LBD_TR 
Click on image for an interactive view with Cn3D
The ligand binding domain of thyroid hormone receptor, a members of a superfamily of nuclear receptors.
The ligand binding domain (LBD) of thyroid hormone receptors: Thyroid hormone receptors are members of a superfamily of nuclear receptors. Thyroid hormone receptors (TR) mediate the actions of thyroid hormones, which play critical roles in growth, development, and homeostasis in mammals. They regulate overall metabolic rate, cholesterol and triglyceride levels, and heart rate, and affect mood. TRs are expressed from two separate genes (alpha and beta) in human and each gene generates two isoforms of the receptor through differential promoter usage or splicing. TRalpha functions in the heart to regulate heart rate and rhythm and TRbeta is active in the liver and other tissues. The unliganded TRs function as transcription repressors, by binding to thyroid hormone response elements (TRE) predominantly as homodimers, or as heterodimers with retinoid X-receptors (RXR), and being associated with a complex of proteins containing corepressor proteins. Ligand binding promotes corepressor dissociation and binding of a coactivator to activate transcription. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, TR has a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).
Statistics
?
PSSM-Id: 132733
View PSSM: cd06935
Aligned: 12 rows
Threshold Bit Score: 359.898
Threshold Setting Gi: 115732680
Created: 19-Nov-2008
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 20 residues -Click on image for an interactive view with Cn3D
Feature 1:ligand binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                       #  ## ##  #  #   
1NAV_A        17 PEEWDLIHIATEAHRSTnaqgshwkqrrkf----------lpddigqspivsmPDGDKVDLEAFSEFTKIITPAITRVVD 86  human
1N46_A        13 DEEWELIKTVTEAHVATnaqgshwkqkrkf----------lpedigqapivnaPEGGKVDLEAFSHFTKIITPAITRVVD 82  human
1BSX_A        15 DEEWELIKTVTEAHVATnaqgshwkqkrkf----------lpedigqapivnaPEGGKVDLEAFSHFTKIITPAITRVVD 84  human
2PIN_A         8 DEEWELIKTVTEAHVATnaqgshwkqkrkf----------lpedigqapivnaPEGGKVDLEAFSHFTKIITPAITRVVD 77  human
3D57_A        22 DEEWELIKTVTEAHVATnaqgshwkqkrkf----------lpedigqapivnaPEGGKVDLEAFSHFTKIITPAITRVVD 91  human
ABS11249     179 TCPKKVNRYYLNGSPKPgmpvpeaprppvv----------qngvvreadssgaMDDDMVDQDIFSHLAEVITPAIIKVVE 248 Florida lancelet
Q90382       159 AEEWELIHVVTEAHRSTnaqgshwkqkrkf----------lpedigqspmasmPDGDKVDLEAFSEFTKIITPAITRVVD 228 Muscovy duck
P18115       170 SEEWELIRIVTEAHRSTnaqgshwkqrrkf----------lpedigqspmasmPDGDKVDLEAFSEFTKIITPAITRVVD 239 African clawed ...
Q4T8V6       223 SDPSGLIPDPLLDSRATsstfpqlltcpilrpgfsrpadappdkigqspvaptSDGDKVDLEAFSEFTKIITPAITRVVD 302 Tetraodon nigro...
XP_001185977 186 DHEEALIRAILVAHKQTshmyrres---------------------ssgeesePDSKKQKLEDEKPLSEIMTPSIVKVVE 244 purple urchin
P10828       216 DEEWELIKTVTEAHVATnaqgshwkqkrkf----------lpedigqapivnaPEGGKVDLEAFSHFTKIITPAITRVVD 285 human
Q9PVE4       141 QEEWEMIRVVTEAHMATnaqgnhwkqkrkflsavg-vkeakpedigsapivnaPEGNKVDIEAFSQFTKIITPAITRVVD 219 zebrafish
Feature 1                                #  #   #           ###         #  # #      #            
1NAV_A        87 FAKKLPMFsELPCEDQIILLKGCCMEIMSLRAAVRYDPESDTLTLSGEMaVKREQLKNGGLGVVSDAIFELGKSLSaFNL 166 human
1N46_A        83 FAKKLPMFcELPCEDQIILLKGCCMEIMSLRAAVRYDPESETLTLNGEMaVTRGQLKNGGLGVVSDAIFDLGMSLSsFNL 162 human
1BSX_A        85 FAKKLPMFcELPCEDQIILLKGCCMEIMSLRAAVRYDPESETLTLNGEMaVTRGQLKNGGLGVVSDAIFDLGMSLSsFNL 164 human
2PIN_A        78 FAKKLPMFcELPCEDQIILLKGCCMEIMSLRAAVRYDPESETLTLNGEMaVTRGQLKNGGLGVVSDAIFRLGMSLSsFNL 157 human
3D57_A        92 FAKKLPMFcELPCEDQIILLKGCCMEIMSLRAAVRYDPESETLTLNGEMaVTRGQLKNGGLGVVSDAIFRLGMSLSsFNL 171 human
ABS11249     249 FAKQIPGFtKLVPDDQVALLKNCCFEVMCLRAASRFDKQRRTITMFGGLtVTKEQVSQGGLGRLAEPLFEFAEGLSqLHL 328 Florida lancelet
Q90382       229 FAKKLPMFsELPCEDQIILLKGCCMEIMSLRAAVRYDPESETLTLSGEMaVKREQLKNGGLGVVSDAIFDLGKSLSaFNL 308 Muscovy duck
P18115       240 FAKKLPMFsELTCEDQIILLKGCCMEIMSLRAAVRYDPDSETLTLSGEMaVKREQLKNGGLGVVSDAIFDLGRSLAaFNL 319 African clawed ...
Q4T8V6       303 FAKKLPMFsELPCEDQIILLKGCCMEIMSLRAAMRYDPESETLTLSGEMaVKREQLKNGGLGVVSDAIFDLGKSLAqFNL 382 Tetraodon nigro...
XP_001185977 245 FAKRIPGFtGLHHDDQILLLKTCCMEIMCLRVAQKFDPDSQKLILSNGLrVGKSDMDHGVLSELIEPIFDFAVSMSrLQL 324 purple urchin
P10828       286 FAKKLPMFcELPCEDQIILLKGCCMEIMSLRAAVRYDPESETLTLNGEMaVTRGQLKNGGLGVVSDAIFDLGMSLSsFNL 365 human
Q9PVE4       220 FAKKLPMFcELPCEDQIILLKGCCMEIMSLRAAVRYDPESDTLTLNGEMaVTRGQLKNGGLGVVSDAIFDLGVSLSsFNL 299 zebrafish
Feature 1                                                                                        
1NAV_A       167 DDTEVALLQAVLLMSTDRs---------------------------GLLCVDKIEKSQEAYLLAFEHYVNhrKHNIPHFW 219 human
1N46_A       163 DDTEVALLQAVLLMSSDRp---------------------------GLACVERIEKYQDSFLLAFEHYINyrKHHVTHFW 215 human
1BSX_A       165 DDTEVALLQAVLLMSSDRp---------------------------GLACVERIEKYQDSFLLAFEHYINyrKHHVTHFW 217 human
2PIN_A       158 DDTEVALLQAVLLMSSDRp---------------------------GLACVERIEKYQDSFLLAFEHYINyrKHHVTHFW 210 human
3D57_A       172 DDTEVALLQAVLLMSSDRp---------------------------GLACVERIEKYQDSFLLAFEHYINyrKHHVTHFW 224 human
ABS11249     329 DDTEVALLAALLVVADRP----------------------------GVQDQESIDRLQDIILTAYKNYITrqRPHQPVLW 380 Florida lancelet
Q90382       309 DDTEVALLQAVLLMSSDRt---------------------------GLICVDKIEKCQETYLLAFEHYINyrKHNIPHFW 361 Muscovy duck
P18115       320 DDTEVALLQAVLLMSSDRt---------------------------GLICTDKIEKCQETYLLAFEHYINhrKHNIPHFW 372 African clawed ...
Q4T8V6       383 DDTEVALLQAVLLMSSGNrrrgrprpspapgstssssssssssdrsGLTCTDKIEKCQETYLLAFEHYINyrKHNIPHFW 462 Tetraodon nigro...
XP_001185977 325 TETEMALLAAVLLIAGDRp---------------------------GLKEAKLVETLQDSLLTAFQHFINesRPKTPVHW 377 purple urchin
P10828       366 DDTEVALLQAVLLMSSDRp---------------------------GLACVERIEKYQDSFLLAFEHYINyrKHHVTHFW 418 human
Q9PVE4       300 DDSEVALLQAVILLSSDRp---------------------------GLTSVERIERCQEEFLLAFEHYINyrKHKVAHFW 352 zebrafish
Feature 1                        #      #            #   
1NAV_A       220 PKLLMKVTDLRMIGACHASRFLHMKVECPTELfPPLFLEV 259 human
1N46_A       216 PKLLMKVTDLRMIGACHASRFLHMKVECPTELfPPLFLEV 255 human
1BSX_A       218 PKLLMKVTDLRMIGACHASRFLHMKVECPTELfPPLFLEV 257 human
2PIN_A       211 PKLLMKVTDLRMIGACHASRFLHMKVECPTELfPPLFLEV 250 human
3D57_A       225 PKLLMKVTDLRMIGACHASRFLHMKVECPTELfPPLFLEV 264 human
ABS11249     381 GKILMKVTDLRALSVAHAEQVKLVKMECTNDI-PPLFLEM 419 Florida lancelet
Q90382       362 PKLLMKVTDLRMIGACHASRFLHMKVECPTELfPPLFLEV 401 Muscovy duck
P18115       373 PKLLMKVTDLRMIGACHASRFLHMKVECPTELfPPLFLEV 412 African clawed frog
Q4T8V6       463 PKLLMKVTDLRMIGACHASRFLHMKVECPNELfPPLFLEV 502 Tetraodon nigroviridis
XP_001185977 378 AKILMKITDLRTISARHAERIMCIKLDRPNEI-PQIFLEM 416 purple urchin
P10828       419 PKLLMKVTDLRMIGACHASRFLHMKVECPTELfPPLFLEV 458 human
Q9PVE4       353 PKLLMKVTDLRMIGACHASRFLHMKVECPTELfPPLFLEV 392 zebrafish

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap