1R1Z,1GV9


Conserved Protein Domain Family
lectin_ERGIC-53_ERGL

?
cd06902: lectin_ERGIC-53_ERGL 
Click on image for an interactive view with Cn3D
ERGIC-53 and ERGL type 1 transmembrane proteins, N-terminal lectin domain
ERGIC-53 and ERGL, N-terminal carbohydrate recognition domain. ERGIC-53 and ERGL are eukaryotic mannose-binding type 1 transmembrane proteins of the early secretory pathway that transport newly synthesized glycoproteins from the endoplasmic reticulum (ER) to the ER-Golgi intermediate compartment (ERGIC). ERGIC-53 and ERGL have an N-terminal lectin-like carbohydrate recognition domain (represented by this alignment model) as well as a C-terminal transmembrane domain. ERGIC-53 functions as a 'cargo receptor' to facilitate the export of glycoproteins with different characteristics from the ER, while the ERGIC-53-like protein (ERGL) which may act as a regulator of ERGIC-53. In mammals, ERGIC-53 forms a complex with MCFD2 (multi-coagulation factor deficiency 2) which then recruits blood coagulation factors V and VIII. Mutations in either MCFD2 or ERGIC-53 cause a mild form of inherited hemophilia known as combined deficiency of factors V and VIII (F5F8D). In addition to the lectin and transmembrane domains, ERGIC-53 and ERGL have a short N-terminal cytoplasmic region of about 12 amino acids. ERGIC-53 forms disulphide-linked homodimers and homohexamers. ERGIC-53 and ERGL are sequence-similar to the lectins of leguminous plants. L-type lectins have a dome-shaped beta-barrel carbohydrate recognition domain with a curved seven-stranded beta-sheet referred to as the "front face" and a flat six-stranded beta-sheet referred to as the "back face". This domain homodimerizes so that adjacent back sheets form a contiguous 12-stranded sheet and homotetramers occur by a back-to-back association of these homodimers. Though L-type lectins exhibit both sequence and structural similarity to one another, their carbohydrate binding specificities differ widely.
Statistics
?
PSSM-Id: 173890
View PSSM: cd06902
Aligned: 15 rows
Threshold Bit Score: 398.621
Threshold Setting Gi: 21263616
Created: 24-Mar-2005
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
metal bindingcarbohydrate
Conserved site includes 8 residues -Click on image for an interactive view with Cn3D
Feature 1:metal binding site [ion binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                             
1R1Z_A             31 RRFEYKYSFKGPHLVQSDGTVPFWAHAGNAIPSADQIRIAPSLKSQRGSVWTKTKAA-FENWEVEVTFRVTGRGRIGADG 109 Norway rat
AAQ86834           29 RKFEYKYSFKGPYLAQKDGSVPFWEYGGNCIASEEMVRITPSLKSKKGSIWSKLPTS-FPWWEVELVFRTTGTGRIGADG 107 black-legg...
FlyBase:CG6822-PA  33 RRFEYKYSFKPPYLAQKDGTVPFWEYGGNAIASSESVRVAPSLRSQKGAIWTKSQTN-FDWWDVEIVFRVTGRGRIGADG 111 fruit fly
CAB03169           26 KKFEYKHSFRAPNLAQRDGSIPFWIVSGDAIASGEQLRLAPSMRSRKGIAWNKRAFLeSENFQVDIALKIGGQGRVGADG 105 Caenorhabd...
XP_780803          28 KKFEYKYSFKGPHLIQKDETVPFWQYGGSALASEDKVRVTPSLRSRRGYIWSKMETS-FDWWEIEVIFKVTGRGRVGADG 106 purple urchin
AAH91860           31 RRFEYKYSFKGPHLTQSDGRIPFWIHTGNAIPSSDQVRITPSLRSQKGSVWTKSPVS-FEHWEAEVAFRVSGRGRMGADG 109 zebrafish
BAB20045           28 RRFEYKHSFKGPHLIQEDLTVPFWTLLGDTVAGDDQIRLVPSIRDKKGLAQSHYPFP-HQNWEVEVHIRVEGRGKVGADG 106 Polyandroc...
XP_001625505        6 VKFEYKYSFKGPHLVNKQGSIPFWNFGGSAMPSNEQVRLTPSLRDKKGFMWTANKFT-SEWWEIEVSFRVTGRGRVGADG 84  starlet se...
XP_001520748       33 RRFEYKFSFRGPRLAQPGREMPFWSHHGDAIPGLEEVRLVPSMRNKSGAVWTRNRIP-FLNWEVEVAIRVSGLGRLGADG 111 platypus
Q8VCD3             32 RRFEYKLSFKGPRLAVPGAGIPFWSHHGDAILGLEEVRLVPSMKNRSGAVWSNISVS-FPSWEVEMQMRVTGPGRRGAQG 110 house mouse
Feature 1                                           # ####   ##                  #                    
1R1Z_A            110 LAIWYTENQGl-dGPVFGSADMWNGVGIFFDSFDNDgkkNNPAIVVVGNNGQINYDHQNDGATQALASCQRDFRNKPYPV 188 Norway rat
AAQ86834          108 LAFWYTDKKQa-eGPVFGSSDKWTGLAIFFDSFDNDnkhNNPYIMGMVNDGTKAYDHESDGANQQLAGCQRDFRNKPYPV 186 black-legg...
FlyBase:CG6822-PA 112 LAFWYTTEKGdynGPVFGSSDRWNGLAIMFDSFDNDnkhNNPYISAVLNDGTKLYDHAEDGTTQLLSGCLRDFRNKPFPT 191 fruit fly
CAB03169          106 LGIWYTSQLGa-lGPVFGGNDFWTGMGLFLDSFDNDgqkNNPQVSLMLNDGTRSYDHHTDGSQQILSSCQRDFRNKPYPV 184 Caenorhabd...
XP_780803         107 LGIWFTQTRGe-eGGVYGSSDKWNGMGLFFDSFDNDnqrNNPYILVVTNDGTKQYDHHNDGLMQQLGGCMRDFRNKPFPV 185 purple urchin
AAH91860          110 LAIWFTAGQGl-eGPVYGAVDQWNGVGIFFDSFDNDgkkNNPAVLVVGNNGKLVFDHQNDGTTQALGTCLRDFRNKPYPI 188 zebrafish
BAB20045          107 LAIWYTSAPPe-lGSVFGSNNHWTGLGVLLDSFDNDsklDNPLISVVYNDGTMEFQHGNDGINQYSGSCRFDFRNKPYPV 185 Polyandroc...
XP_001625505       85 LAIWFTEKPGe-eGPVFGSSDKWTGLGVLCDSFDNDgqqNNPFVSVMVNDGTKNYEHYNDGKNQHLGGCLRDFRNRPHPV 163 starlet se...
XP_001520748      112 MAIWYSQERGq-tGPALGGPALWEGIGIFLDSFDDDa-qNNPAIQVVASNGRIPYDRLKDGGAQVLGSCVRDFRNRLHPF 189 platypus
Q8VCD3            111 VAMWYTKDRAq-vGSVVEELASWDGIGIYFDSSTSDv-qDSPVIRVLASDGHDLQEQSGDGNVRELGSCHRDFRNRPFPF 188 house mouse
Feature 1                                                                                  
1R1Z_A            189 RAKITYYQKTLTVMINNGFTPdkNDYEFCAKVENMVIP-TQGHFGISAATGGL-ADDHDVLSFLTFQLT 255 Norway rat
AAQ86834          187 RAKIEYFNNILTVLFHNGNTNndGDYEMCFRAENVFLP-TNGHFGVSAATGGL-ADDHDALKFLTTSLH 253 black-legged tick
FlyBase:CG6822-PA 192 RARIEYYNNVLTVMIHNGMSNnnDDYELCLRADGVNLP-KNGYFGISAATGGL-ADDHDVFHFLTTSLH 258 fruit fly
CAB03169          185 RIRIEYLKNVLTVHIDDGMQPt-PRYELCMRAENIFLP-RNGYFGVSAATGGL-ADDHDVLDFSVFSLF 250 Caenorhabditis elegans
XP_780803         186 RAKVEYYKNVLTVYFHQGLSAndHDYELCMRAENVYLP-QKGYFGVSAATGGL-ADDHDVMKFLTHSLA 252 purple urchin
AAH91860          189 RTKITYYKQTLSVFINNGFTPdkDDYEFCTKVENMIIP-GTGYFGISAATGGL-ADDHDVLSFLLFRLT 255 zebrafish
BAB20045          186 RIKLTYYQEVLTVSYTSGNLPg-DDFVTCTTVENIVIP-PNYYFGVSAATGGL-ADDHDVLKFLTWSIS 251 Polyandrocarpa misaki...
XP_001625505      164 RVRVRYYQNVLTLWFHSGMSTsnEEFELCTRVENVNLPkEGGYFGLSAATGGL-ADDHDAFSFSTLTLT 231 starlet sea anemone
XP_001520748      190 RVKITYWREKLRVSINSGFTAhgGVDELCTEVAPLSLS-PSGFFGVSASTSSL-ADDHDVLSFSTFSLS 256 platypus
Q8VCD3            189 RARVTYWRQRLRVSLSGGLTPk-DPEEVCVDVEPLFLA-PGGFFGVSAATGTLaADDHDVLSFLTFSLR 255 house mouse

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap