Conserved Protein Domain Family
PX_PLD

?
cd06895: PX_PLD 
The phosphoinositide binding Phox Homology domain of Phospholipase D
The PX domain is a phosphoinositide (PI) binding module present in many proteins with diverse functions such as cell signaling, vesicular trafficking, protein sorting, and lipid modification, among others. Phospholipase D (PLD) catalyzes the hydrolysis of the phosphodiester bond of phosphatidylcholine to generate membrane-bound phosphatidic acid and choline. Members of this subfamily contain PX and Pleckstrin Homology (PH) domains in addition to the catalytic domain. PLD activity has been detected in viruses, bacteria, yeast, plants, and mammals, but the PX domain is not present in PLDs from viruses and bacteria. PLDs are implicated in many cellular functions like signaling, cytoskeletal reorganization, vesicular transport, stress responses, and the control of differentiation, proliferation, and survival. Vertebrates contain two PLD isozymes, PLD1 and PLD2. PLD1 is located mainly in intracellular membranes while PLD2 is associated with plasma membranes. The PX domain is involved in targeting of proteins to PI-enriched membranes, and may also be involved in protein-protein interaction.
Statistics
?
PSSM-Id: 132805
View PSSM: cd06895
Aligned: 16 rows
Threshold Bit Score: 142.906
Threshold Setting Gi: 170575336
Created: 10-Jul-2008
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
phosphoinosit..
Feature 1:phosphoinositide binding site [chemical binding site]
Evidence:
  • Comment:A majority of PX domain containing proteins binds phosphatidylinositol-3-phosphate (PI3P) at this site. In some cases, other phosphoinositides, such as PI4P or PI(3,4)P2, are the preferred substrates.
  • Comment:based on the structures of phosphatidylinositol-3-phosphate bound to other members of this superfamily
  • Comment:Two basic residues are key in binding with phosphoinositides: one forms hydrogen bonds with the 3-phosphate of PI(3)P and another forms hydrogen bonds with the 4-and 5-hydroxyl groups of PI(3)P.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                   ###                                   
P70496         78 GCPVKAQVLEVERFTst-srMPSVNLYTIELTHGEFTWQVKRKFKHFQEFHRELLKykAFIRipiptkrhtf-------- 148  Norway rat
P70498         62 GVPVIAQVVGTERYTsg-skVGTCTLYSVRLTHGDFTWTTKKKFRHFQELHRDLQRhkVLMSllnlarfaaa-------- 132  Norway rat
CAQ13667       28 EVPILVQVTEVERFTss--rVLNPNLYTVELSHGDFKWKIKRRFKHFQALHQELLKfrALLKiplpsrihsvnr------ 99   zebrafish
ACF94297       78 GTAFSVEVTDVERFGss-rrTEKTCRYTVRISHGPFEWAIKRRYKHFHQLHQELQRyrALLHlqrparrlkehrls---- 152  inshore hagfish
XP_002120579   93 KTPLSVNITCVKHDVty-rhPLNPNLYTIELAHGQFTWTIYRRYKHFIELHEKLWTyrASLKiplpskkhrrr------- 164  Ciona intesti...
XP_002230008   70 GEPIDVKIIDVERSYrr--kPLNPNLYTINLQHGEHNWTIKRRYKHFIQLHEAILLfkASLHvpvptarqre-------- 139  Florida lancelet
ACF94296       66 NTEIHVRVTENVRVGkq--kQGGNSPYKVEFTHGEFVWNIRCSFKQVQALHNALRQyrTLLHlplltrnfqd-------- 135  inshore hagfish
XP_001893198   58 GVPVKARITDVKRDEkfglhLINAYLYVIELEHGPFRWTVVKQNKDFAVLAARLLThrAAERirapvrraqevlddales 137  agent of lymp...
XP_001768890   18 TELPTARVVEVSRSErndqsLAFQLVYTIELQYKQFTWRLERKATQLLFLHLALKKr-ALLEdiqerqeqikewahnlgf 96   Physcomitrell...
AAF26134       42 DELPKAAIVSVSRPDtt-dfSPLLLSYTLELQYKQFKWTLQKKASQVLYLHFALKKr-LIIEelhdkqeqvrewlhslgi 119  thale cress
Feature 1                                                                                         
P70496            --------------------------------------------------------------------------------      Norway rat
P70498            --------------------------------------------------------------------------------      Norway rat
CAQ13667      100 ------------------------------------------------------------------------------rs 101  zebrafish
ACF94297      153 ----------------------------------------------------------------------------mrre 156  inshore hagfish
XP_002120579  165 ------------------------------------------------------------------------------rl 166  Ciona intesti...
XP_002230008      --------------------------------------------------------------------------------      Florida lancelet
ACF94296          --------------------------------------------------------------------------------      inshore hagfish
XP_001893198  138 igvdiipdhrndcpyrktsdhqkihnlnrsddrdnihqsgttkneinteqqsvptdftrtasvripnvspxtrenilkqr 217  agent of lymp...
XP_001768890   97 gdeh---------------------------------------------------------------pststttnlrshs 113  Physcomitrell...
AAF26134      120 fdmqgs-----------------------------------------------------------vvqddeepddgalpl 140  thale cress
Feature 1                         ##                   #                              
P70496        149 rrqnvkeepREMPSLPRSSEnai-------qeEQFFGRRKQLEDYLTKILKMpMYRNYHATTEFLDVS 209  Norway rat
P70498        133 hspareaanENIPSLPRGGSeg--------saRHTASKQKYLENYLNRLLTMsFYRNYHAMTEFLEVS 192  Norway rat
CAQ13667      102 fkgrkrfhgERIPTLPRRPDalv-------reEQLISRKMQLEDYLRNVLKKpLYRTHPATLEFLEVS 162  zebrafish
ACF94297      157 rkvnaedktSRPPQLPARIDssqqdntpanveTNLSSRKKHVENYLQTLLRIpVYRDHPSTLEFLEVS 224  inshore hagfish
XP_002120579  167 tthgmpkkeSKMPQFPKTPEilv-------ssEDLDKRKDQLCLYLQAMLKSrMYRKHPATFKFTGVA 227  Ciona intestinalis
XP_002230008  140 krksvkgqpRKLPKLPKTPDali-------tgARLNRRMEQLEIYLQRLVNIrTFRNLEPTLKFLEVS 200  Florida lancelet
ACF94296      136 ripksasgnRRIPELPNELLtpesed-ldleaGPMSSHKRQIENYLSSILKIsIYRNHQTTLDVLEVS 202  inshore hagfish
XP_001893198  218 nvrlseikrHQLPSLGFVPDa----------vIDPNERRQRLEKWLQAVLHIpVNRNHHETAEFLEVS 275  agent of lymphatic filari...
XP_001768890  114 shherhssqGDIPSSAALPVirpai---grlpDISPRATAAMQNYLNHFLESlDIVNTVEVCKFLEVS 178  Physcomitrella patens sub...
AAF26134      141 hytedsiknRNVPSRAALPIirpti---grseTVVDRGRTAMQGYLSLFLGNlDIVNSKEVCKFLEVS 205  thale cress

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap