2ETT


Conserved Protein Domain Family
PX_SNX22

?
cd06880: PX_SNX22 
Click on image for an interactive view with Cn3D
The phosphoinositide binding Phox Homology domain of Sorting Nexin 22
The PX domain is a phosphoinositide (PI) binding module present in many proteins with diverse functions. Sorting nexins (SNXs) make up the largest group among PX domain containing proteins. They are involved in regulating membrane traffic and protein sorting in the endosomal system. The PX domain of SNXs binds PIs and targets the protein to PI-enriched membranes. SNXs differ from each other in PI-binding specificity and affinity, and the presence of other protein-protein interaction domains, which help determine subcellular localization and specific function in the endocytic pathway. SNX22 may be involved in recruiting other proteins to the membrane via protein-protein and protein-ligand interaction. The biological function of SNX22 is not yet known.
Statistics
?
PSSM-Id: 132790
View PSSM: cd06880
Aligned: 15 rows
Threshold Bit Score: 155.895
Threshold Setting Gi: 156398285
Created: 10-Jul-2008
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
phosphoinosit..
Conserved site includes 6 residues -Click on image for an interactive view with Cn3D
Feature 1:phosphoinositide binding site [chemical binding site]
Evidence:
  • Comment:A majority of PX domain containing proteins binds phosphatidylinositol-3-phosphate (PI3P) at this site. In some cases, other phosphoinositides, such as PI4P or PI(3,4)P2, are the preferred substrates.
  • Comment:based on the structures of phosphatidylinositol-3-phosphate bound to other members of this superfamily
  • Comment:Two basic residues are key in binding with phosphoinositides: one forms hydrogen bonds with the 3-phosphate of PI(3)P and another forms hydrogen bonds with the 4-and 5-hydroxyl groups of PI(3)P.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                           ###                       ## 
2ETT_A        10 LEVHIPSVGPEAEGprq--------speKSHMVFRVEVLCSGR--RHTVPRRYSEFHALHKRIKKLYK---VPDFPSKRL 76  human
NP_001083208   2 IEVCVPSVGHELYKs------------dKTHTVFRMDVLFNGR--RHTLDRRYSEFHALHKLLKKTCK---VPDFPPKRV 64  African clawed ...
NP_001028903   4 IEVSIPSFRSEGSTv------------eKGYTVFKIEVLMCGR--QHTVEKRYSEFHALHRMLKKIIK---PPEIPSKHV 66  zebrafish
XP_001231641   2 IVVSIPAAEPEVTArs----------peKAHTVFLVEVLCNGR--RHTVAKRYSEFQALHKRIKKSCK---VPDFPPRRV 66  chicken
NP_001038839  11 IEVFIPSLMREVDEt------------gKLRKLFRVEILFNGR--KHFVLRRHGEFQTLHRKVKKILR---VPDFPSKRN 73  zebrafish
XP_001607242   2 YQVFISGYRLANVSh------------gKPYYVYTVEMVDSNNgaRYLIEKRYSEFNTLHRMLKKDCH---TAPFPPKRV 66  jewel wasp
XP_002249290 108 LCSPVPWFTCAHLShdlpvptcpmvylcPPVQVFVIEVCAAGR--RHTLEKRYSELHTLHRELKKSYL---TPEFPPKRV 182 Florida lancelet
XP_001949599   2 TEITIPKYGLVHDV--------------KPHYVYTIKVLSAGI--QECVEKRYSAFHAFHRELRKSIS---TPPFPSKRI 62  pea aphid
EEC08421       2 IRVFVPNYRQVYAPn------------gRQYVVYCVEVTVSGV--CHKLERRYRTFHALHKKVKRMLGnraPSGFPPKRL 67  black-legged tick
EEB15389       2 NEIKIENYRIVENGs------------kKPFCLYTIEIYVNGT--RYVVEKRYSQFHALHEELRKLHP---TPNFPPKKV 64  human body louse
Feature 1                  #                                     
2ETT_A        77 PNWRTRGLEQRRQGLEAYIQGILYLNQeVPKELLEFLRLRHFPTDPKA 124 human
NP_001083208  65 PNWMQKVQEHRRQGLEAYIQGVLWYNTdVPKELLDFLKVRHFHKEIKN 112 African clawed frog
NP_001028903  67 RNWVPKVLEQRRQGLELYLQTIIMENEvLPKIFLDFLNIRHFPSLPKT 114 zebrafish
XP_001231641  67 PNWVPKVLEQRRQGLELYIQGVLCHNEeLPQDVLDFLKVRRCQQELKD 114 chicken
NP_001038839  74 QHLRTKPLEQRRQELEDYIQVILYQNDvVPQELLDFLQVKHFHPTSKN 121 zebrafish
XP_001607242  67 RNSNPKVLEQRRAALEIYMQKMLRLAS-TKQQVLNFLGIDGANSEIYH 113 jewel wasp
XP_002249290 183 RNWNPKVLEQRRRGLETYLQGLIHQDI-LPKILLDFLEINMATQLGYE 229 Florida lancelet
XP_001949599  63 RCSQPKVLEQRRAGLERYLQTVFKIEG-GYKQVMEFLGLEYQPSHKID 109 pea aphid
EEC08421      68 RSLNPKLLEQRRIGLEHYLQNLVRVPT-LSNQLLSFLEVPTPMSPAAS 114 black-legged tick
EEB15389      65 RSLQQRVLEKRKQALEKYLLTMLKFQQ-SRSHVLSFLGINKPENNHSS 111 human body louse

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap