Conserved Protein Domain Family
GT_GPT_euk

?
cd06855: GT_GPT_euk 
UDP-GlcNAc:dolichol-P GlcNAc-1-P transferase (GPT) catalyzes the transfer of GlcNAc-1-P from UDP-GlcNAc to dolichol-P to form GlcNAc-P-P-dolichol. The reaction is the first step in the assembly of dolichol-linked oligosaccharide intermediates and is essential for eukaryotic N-glycosylation. GPT activity has been identified in all eukaryotic cells examined to date. A series of six conserved motifs designated A through F, ranging in length from 5 to 13 amino acid residues, has been identified in this family. They have been determined to be important for stable expression, substrate binding, or catalytic activities.
Statistics
?
PSSM-Id: 133465
View PSSM: cd06855
Aligned: 29 rows
Threshold Bit Score: 184.372
Threshold Setting Gi: 41614857
Created: 28-Oct-2008
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
Mg++ bindingputative
Feature 1:Mg++ binding site [ion binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                        
XP_001624100  23 IPRVKMLFAFAGLAGKDMNKKDnk---------------------dPIPEGLGAVGGALFLICMFlfiplpflsiwlekg 81  starlet sea ane...
XP_001320417  48 IPRCMNAHLRRNLGGIDINKENdke------------------npkKIPESMGLQSSSAFLFALViiaafs--------- 100 Trichomonas vag...
XP_001697886  52 VPKVAAKTQARGICGKDLNKKGtpa------------------gdkPIPESAGLAPGCVFLLCVIcfellhyyd------ 107 Chlamydomonas r...
XP_651906     50 IPHMGNKCIEKGLFGLDINKGTq----------------------dKIPESMGLVCGIVFMFITMlfssl---------- 97  Entamoeba histo...
CAQ39610      68 LPRFIHFLHEKGLYGIDLNKISk----------------------dKVAQPIGLFPSILYLIFTLfyqllyyd------- 118 Plasmodium know...
O22211        99 IPVTARYVLRRNMFGFDINKRGtpq------------------gdiKVPESLGIVVGIVFLIVAIifqyfnft------- 153 thale cress
P42864        41 IPNVARTLLDRNIFGIDINKSTeeqrqkfaakrragqteekefqkqAIPESLGILVGAMYLSVVVvltvclrflga---- 116 Leishmania amaz...
XP_765645     61 LTYFGTFFLIKLLKLRGLVSNNlnne-----------------tdeKVPEPGALVGCVLYILSMIfvqlllgd------- 116 Theileria parva...
XP_001704857  29 ILELAPKLEKAGLSGRDLNKAVs----------------------eKIPEDAGLGPSAMFLLTISlwslvm--------- 77  Giardia lamblia...
CAL56387     110 LAYWMTMRLIPFVAAKTLSRNMrg--------------------etRVPESAGLACGGAYAMALTmqqlcqrlvrvafgq 169 Ostreococcus tauri
Feature 1                                    ##                                                  
XP_001624100  82 dfdfphhefvmFIAALLSICCMIFLGFADDVLDLKWRDKLILPTMASLPLLMVyfvnigvttiivpk------------- 148 starlet sea ane...
XP_001320417 101 ------nekkdLYPALVSVVITTLLGFADDVLDIPWRVKIVIPIFTVLPLVLDyngstticlkgfllp------------ 162 Trichomonas vag...
XP_001697886 108 --igslawlvdYNAALATIGFMLFLGFSDDVLDIRWRVKLILPLFASLPLLVAysggtgialpkpl-------------- 171 Chlamydomonas r...
XP_651906     98 ------isipnYIISLLVILFNFIIGLIDDFLDIRWRYKLILSFCSSALIVIIypgscil-------------------- 151 Entamoeba histo...
CAQ39610     119 ----dhkilleYNAGLLSIIFITFLGFIDDILELKWRYKVVLPFFASLPLLLSysgntniripsfl-------------- 180 Plasmodium know...
O22211       154 ---edsnwlveYNAALASICFMILLGFVDDVLDVPWRVKLVLPSFATLPLLMAyaghttivipkpl-------------- 216 thale cress
P42864       117 agegldnpyasLPGPLMTITVMLLLGFVDDVLDVKWRHKIILTALGSLPLIMTydgslsvlmpcafgrfglstmnvmkew 196 Leishmania amaz...
XP_765645    117 ----kcgkyfkVNPGLASIVLMTLLGLIDDVLLLNWFSKIAGPVLASLPLCLAycgtkigileyl--------------- 177 Theileria parva...
XP_001704857  78 ------prsstLLSAGFSIMASSFLGFVDDVVNLRWRYKLIVPSITLLPLVGAysgsglsl------------------- 132 Giardia lamblia...
CAL56387     170 sagsaeswaveSNSALACVGYMVFLGFVDDVLDLPWRAKIVSPGFAALPLLLSyggattvlvpspvra------------ 237 Ostreococcus tauri
Feature 1                                                                                        
XP_001624100 149 ----------------------------------pvrfifgfdldlgiLYYVYMGMLAVFCTNAINILAGINGVEAGQSL 194 starlet sea ane...
XP_001320417 163 ----------------------------------lrkifrfqcidigfLYQIFICLLTVFCTHSINIYAGINGLEAGQSF 208 Trichomonas vag...
XP_001697886 172 -----------------------------------aalglppylelgiLYKVYMVMLGIFCTNSINILAGVNGLEAGQTF 216 Chlamydomonas r...
XP_651906    152 -----------------------------------------fginlsiIYPFALICLSVFFTNSINMFAGVNGLESGQCI 190 Entamoeba histo...
CAQ39610     181 -----------------------------------nfifkeriidigfFYYLYIILLCVFCTNAINIYAGINGLEIGQSL 225 Plasmodium know...
O22211       217 -----------------------------------vayiglevlnlgrIYKLYMGLLAVFCTNSINIHAGLNGLEIGQTV 261 thale cress
P42864       197 rlglaapqgeptttfratapstwfsftvnhrsyvkvtesgaaliylgpVYLVYLSMLCIFCTNSINILAGVNGVEVGQSI 276 Leishmania amaz...
XP_765645    178 ------------------------------------pkpinsgsyvklLSCFYIAILTVFCANSINIYAGINGLELGQSL 221 Theileria parva...
XP_001704857 133 ----------------------------------------gplrltssMTKLYCLLFAIFSQNAVNIYAGINGLEVGQSI 172 Giardia lamblia...
CAL56387     238 ---------------------------------mfnfpadvrsidigaLYMVYMWLLVVFCSNSINIHAGLNGLEAGQSL 284 Ostreococcus tauri
Feature 1                                                                                        
XP_001624100 195 IIAMSIVLFNllelqgt-------------------ccwqnhlFSLYFMLPFIAVCSALLYYNWYPSSIFVGDTFCYFAG 255 starlet sea ane...
XP_001320417 209 IVACFLLFHSlyywnv----------------------dkqaqAAATILIPFITSTYALLHFNWYPSRVFVGDTFTLTAG 266 Trichomonas vag...
XP_001697886 217 IVACAVLLHNllsvagwpgwgag--------gadaaaardghlFSAGLMLPLAATTFGLLVFNWYPSKVFVGDTFTYFAG 288 Chlamydomonas r...
XP_651906    191 IISAYSILHNiivllttss----------------skqyeaslLSLYLLIPFIFVTIVLFYYNKFPSKVFVGDSFTYFSG 254 Entamoeba histo...
CAQ39610     226 IIAFFISIHNlieiilnigtgqsk------gitegaqilkqhfLSIIFILPFVSINLVTFSFNFYPSKGFVGNTLTYFCG 299 Plasmodium know...
O22211       262 VIAAAILIHNvmqigasvd----------------peyhqahaFSIFLTQPLMATSLAMLAYNWYPSSVFVGDTYTVFAG 325 thale cress
P42864       277 VIAVASVVYNlfqmrldrqltpdfssldaaaadardmtsdhqlRALLLLGPFIGVSLALWRYNRYPARVFVGDSYTYFAG 356 Leishmania amaz...
XP_765645    222 VMSLFILISNsldiykssgvky----------gefgmnlekkiYVLYLTMPFIAINIALICFNWYPAKLFVGNVYTLFSG 291 Theileria parva...
XP_001704857 173 VACTFLLPIVlyklyvaldttryae---hlapwqrllshpsllSSLVIIVCFLAVSHPVYLLNRYPSRVFVGDIYAYFAG 249 Giardia lamblia...
CAL56387     285 IIAGAVLLLNvmaltsdpsd--------------epitagahlFSISLVLPFIATTLALLTHNWYPSKVFVGDTYTYFAG 350 Ostreococcus tauri
Feature 1                                                                  
XP_001624100 256 MAFAVVGILGHFSKTMLLFFIPQVFNFVFSLPQLFKFVPCPRHRLPRLNPETGKLGMS 313 starlet sea anemone
XP_001320417 267 TTIAAAGILGHFSEMTLLFMLPQIINFVLSLPQLFGIIPCPRHRLPKRNPQTGKLEGI 324 Trichomonas vaginalis G3
XP_001697886 289 MTIAVAGILGHFSETLLLFLLPQVFNFVYSLPQLFGIVHCPRHRLPVFDPATGLLRPK 346 Chlamydomonas reinhardtii
XP_651906    255 GVLGVASIIGGYDRLMFCLFFPEFINFFVSIPQLFGFIYCPRHRLPKLNKETHKLECV 312 Entamoeba histolytica HM-1:IMSS
CAQ39610     300 IFLAVLSIFGHFSKTLILFLIPQFLNFFLSLPQLLNFVPCPRHRLPVVNPKTNKLTYS 357 Plasmodium knowlesi strain H
O22211       326 MTMAVVGILGHFSETLLIFFLPQVLNFLLSLPQLAGIVKCPRHRLPRYDPATGLLTGT 383 thale cress
P42864       357 TVLAVSSITGVYSKTLLLFFAPQVFNFLISLPQLFSIVPCPRHRVPTWNPRTNLLSNS 414 Leishmania amazonensis
XP_765645    292 TFFSVVLIMSNMCEMAPFIFLPQLINFLLSIPQLLGFIPCPRHRVPRFNGRTKKLENS 349 Theileria parva strain Muguga
XP_001704857 250 SVFASACILSDTLIAGPLLFLPQILNFVLSVPQLFGIVPCPRHRLPRFSQDHGTLTGV 307 Giardia lamblia ATCC 50803
CAL56387     351 MTLGVAGTLGHFSETLLLFFFPQVLNFLYSTPQLFKFVHCPRHRLPIFDPKTGLLHPS 408 Ostreococcus tauri

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap