Conserved Protein Domain Family
PLPDE_III_Bif_AspK_DapDC

?
cd06840: PLPDE_III_Bif_AspK_DapDC 
Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Bifunctional Aspartate Kinase/Diaminopimelate Decarboxylase
Bifunctional aspartate kinase/diaminopimelate decarboxylase (AspK/DapDC, EC 4.1.1.20/EC 2.7.2.4) typically exists in bacteria. These proteins contain an N-terminal AspK region and a C-terminal DapDC region, which contains a PLP-binding TIM-barrel domain followed by beta-sandwich domain, characteristic of fold type III PLP-dependent enzymes. Members of this subfamily have not been fully characterized. Based on their sequence, these proteins may catalyze both reactions catalyzed by AspK and DapDC. AspK catalyzes the phosphorylation of L-aspartate to produce 4-phospho-L-aspartate while DapDC participates in the last step of lysine biosynthesis, the conversion of meso-2,6-diaminoheptanedioate to L-lysine.
Statistics
?
PSSM-Id: 143507
View PSSM: cd06840
Aligned: 6 rows
Threshold Bit Score: 644.489
Threshold Setting Gi: 83816719
Created: 16-Jun-2008
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Conserved Features/SitesClick to see Conserved Features Help
 
Feature 1:active site [active site]
Evidence:
  • Comment:Based on the binding of cofactor and substrate to Methanocaldococcus jannaschii Diaminopimelate decarboxylase.
  • Comment:The active site is composed of residues from both subunits of the dimer. There are two active sites in the functional dimer.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                # #                  #                 
ZP_00952864 497 RDALIKIAPQTGGRYVYDL-ETIKARASAVANIKSVNRAFYAMKANPHPDVLKTIFEAGLGFECVSPGELMRLKDTFPGL 575 Oceanicaulis ale...
YP_127113   491 RDRLLTTSAIHSPCYVYHS-PTQAIRARQLSALESIDSLFYAVKANPFPSILKTLEKEGIGFECVSIQELELVLKLFPNI 569 Legionella pneum...
YP_755638   490 RQALLDLCPVDGATYVYDL-ETVKTRASAVAGLKGLDRGWYAMKANGHPDMIRTAVEAGLGVECVSINEVMAARKAVPDL 568 Maricaulis maris...
YP_444447   498 REALLRLADDESPRYVYDP-EVVTARSDEVQGLGPIDQSFYAVKANPHPEVLRLLERRGLGFECVSPGELDRVFEACPGL 576 Salinibacter rub...
EDQ88506    427 RDVLRQKVGDVEPVYVYSRdMAFRQTQRLISNLNAVDSLFFAIKANSHPDVLRAVHAAGAGFECVSQMEIDLILSLFPDI 506 Monosiga brevico...
NP_298406   498 RLLAMRDEEGIGPCYVYHL-PTVRERARQLNAVAAVDQRYYAIKANPHPAILRTLIEEGFGLECVSLGELRHVFAVVPHL 576 Xylella fastidio...
Feature 1              #                                         #                              
ZP_00952864 576 DPkKVLFTPNFAARHEYAAAIELGTNLTIDGLHPLTEWPELFKGVEVILRINPDRPRGHHQHVQTAGPKAKFGIPLDQLD 655 Oceanicaulis ale...
YP_127113   570 KKeRILFTPNFAPKSEYEFALQTGCYVTIDSLYPLENWPELFKNREVIVRIDPGTGAGHHKHVSTGGNESKFGITQNDIS 649 Legionella pneum...
YP_755638   569 PVdRILFTPNFAPRAEYAQALELGIHLTLDGLHPLRAWPEIFSGRKITLRINPQRPEGHHKHVRTAGPEAKFGLHADELV 648 Maricaulis maris...
YP_444447   577 DPaRVLFQPNFAAPAEYADAFERGVHVTVDNVQPLAEHPDVFAGEELFVRVDPGQGEGHHRKVRTAGAQSKFGVVPDDLG 656 Salinibacter rub...
EDQ88506    507 DVrHLLFTPNFAARSEYEHALKLGVNVTVDNSFVLQEWHELFRGAKVLLRIDSGQGQGHHAHVKTGGSASKFGLDVHELA 586 Monosiga brevico...
NP_298406   577 VPsRVLFTPSFASRVEYEQAFLLGVNVTLDNVEALRLWPEVFRDRTLWLRIDLGYGDGHHEKVTTGGKTSKFGLSVTRID 656 Xylella fastidio...
Feature 1                       # #  #                                ##                        
ZP_00952864 656 AARDAAAKAGATVIGLHAHAGSGViEAGHWREIGAILARAAe-gFSDIRILNVGGGLGVPESAEapALDLALVDAELAKL 734 Oceanicaulis ale...
YP_127113   650 KILSLTKSNHIKVIGLHAHSGSGIlSTDLWQQTAVMLASLTd-qFPEVRSINLGGGLGIVEKPGqhPIDFAALDAQLMAV 728 Legionella pneum...
YP_755638   649 EARDLAKKAGAIINGLHVHSGSGIsDPDHWRRVGLFLVDTAr-dMPDVEILDLGGGLSVDEASGvrRIDMDALDQVLTDL 727 Maricaulis maris...
YP_444447   657 RLRAAVDQAGATVVGLHAHVGSGItDESTWAGLVDLLASLAa-eFPAVRALNVGGGLGVPNASGgrPLDLDALDAALGKA 735 Salinibacter rub...
EDQ88506    587 EVAQLCAAHGIEVFGLHCHSGSGVeNTTLWANHLQYLAKLArehFPAARVINVGGGLSIPYTFGgaEVNLKAVDDALAAA 666 Monosiga brevico...
NP_298406   657 EFIDVAKTLNIIVTGLHAHLGSGVeRGDHWSRMYDELAGFAs-rIGSVSTLDIGGGLPIPYRPDdePFDVEAWGVSLAEV 735 Xylella fastidio...
Feature 1                  ####                                   #   #                         
ZP_00952864 735 KQaLPDYEIWMEPGRYPVAESGVLLSAVTQIKHAfGTRFIGLGTGMNSLIRPALYGARHEIVNLSRYDEegtgMASIVGP 814 Oceanicaulis ale...
YP_127113   729 KSqYPGLAIWLEPGRFFVAESGVILAKVTQCKEKgKVKFIGIETGMNSLIRPSLYGAYHEIVNLTRLHEekagFAHIVGP 808 Legionella pneum...
YP_755638   728 KTaHPKYQLWIEPGRYISAESGVLLARVTQLKHTpDARFVGINTGMNSLIRPALYGARHEIVNLTRLDEspayVADIVGP 807 Maricaulis maris...
YP_444447   736 AArHPQYDLWMEPGRYLVAEAGVLLARVTQTKTKdAAAYVGLDTGMNSLLRPALYGAHHEIVNLSRLDEppamTADVVGP 815 Salinibacter rub...
EDQ88506    667 KAeFPQFQVWMEPGRFIAAQCGIVLAKVTQIKHKsGVKFVGVTAGMHTMIRPALYQAYHEVVNISRDGPp--aNAVVCGP 744 Monosiga brevico...
NP_298406   736 KAlHPKLQLVIEPGRFLVAEAGVLLTRVTQVIEKdGIRRVGLEAGMHTLIRPALYDAWHDVENLSRLDEiphvLCDVVGP 815 Xylella fastidio...
Feature 1        #                             #   #   #           
ZP_00952864 815 ICESADLLGADRLMPe-TKEGDVIAIAEAGAYGAVMSSRYNLREPADEVVI 864 Oceanicaulis alexandrii HTCC2633
YP_127113   809 ICESGDTLGYDRLLPv-TKEGDVILIANTGAYGHCMSSHYNLRPPAQEIVL 858 Legionella pneumophila str. Lens
YP_755638   808 ICETADRLGAQRLMPe-TEEGDIILIANGGAYGRVMASSYNMREPAGEAVI 857 Maricaulis maris MCS10
YP_444447   816 VCETGDVLGHDRRLPp-TEPGDTLLVATTGAYGASMSNRYNLREPASEVML 865 Salinibacter ruber DSM 13855
EDQ88506    745 ICESGDVFARERPLPedTREGDVLLIDCCGAYGFCMASTYNLRPLPEELIV 795 Monosiga brevicollis MX1
NP_298406   816 ICESSDVFGRCRHLPaaTASGDLMLIADAGAYGFSMASTYNLRGLPAEVVL 866 Xylella fastidiosa 9a5c

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap