3BTN,3BTN


Conserved Protein Domain Family
PLPDE_III_ODC_like_AZI

?
cd06831: PLPDE_III_ODC_like_AZI 
Click on image for an interactive view with Cn3D
Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Ornithine Decarboxylase-like Antizyme Inhibitor
Antizyme inhibitor (AZI) is homologous to the fold type III PLP-dependent enzyme ODC but does not retain any decarboxylase activity. Like ODC, AZI is presumed to exist as a homodimer. Antizyme is a regulatory protein that binds directly to the ODC monomer to block its active site, leading to its degradation by the 26S proteasome. AZI binds to Antizyme with a higher affinity than ODC, preventing the formation of the Antizyme-ODC complex. Thus, AZI blocks the ability of Antizyme to promote ODC degradation, which leads to increased ODC enzymatic activity and polyamine levels. AZI also prevents the degradation of other proteins regulated by Antizyme, such as cyclin D1.
Statistics
?
PSSM-Id: 143504
View PSSM: cd06831
Aligned: 5 rows
Threshold Bit Score: 718.553
Threshold Setting Gi: 29561807
Created: 13-Jun-2008
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
dimer interface
Conserved site includes 12 residues -Click on image for an interactive view with Cn3D
Feature 1:dimer interface [polypeptide binding site]
Evidence:
  • Comment:The antizyme inhibitor (AzI) crystallizes as a dimer, whose interface displays a smaller buried surface area compared to the ornithine decarboxylase dimer interface. The AzI dimer may not be physiological. Biochemical studies suggest that AzI exists as a monomer in solution.
  • Structure:3BTN; Interface between subunits in Mus musculus Antizyme Inhibitor homodimer; defined at 3.5A contacts.
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                         ###            
3BTN_A        26 DNYVYEHTLTGKNAFFVGDLGKIVKKHSQWQTVVAQIKPFYTVKCNSTPAVLEILAALGTGFACSSKNEMALVQELGVSP 105 house mouse
3BTN_B        26 DNYVYEHTLTGKNAFFVGDLGKIVKKHSQWQTVVAQIKPFYTVKCNSTPAVLEILAALGTGFACSSKNEMALVQELGVSP 105 house mouse
NP_001087651  26 DHYIYDHTLMGKNAFFVADLGKIVKKHFKWKNIMGHIKPFYTVRCNSSPAVLEILAALGMGFACANKNEMSLVYDLGISM 105 African clawed ...
CAD87803      26 DNHIYEQNLAEKNAFVVADLGALMRQHVVWKTTMPLVRPFYPVSCNSSPVVIELLSALGVGFVCANKAETTLVLSHDVPP 105 zebrafish
NP_001008729  26 DNCIYEHTHTGKRAFYVGDLGKLVKKNIQWQNVMAPIKPFYTVRCNSTPGVLEILGTLGIGFACSSKSEMALVQGLGISP 105 chicken
Feature 1                     #                     #                                            
3BTN_A       106 ENIIFTSPCKQVSQIKYAAKVGVNIMTCDNEIELKKIARNHPNAKVLLHIATEDNIggEDGNMKFGTTLKNCRHLLECAK 185 house mouse
3BTN_B       106 ENIIFTSPCKQVSQIKYAAKVGVNIMTCDNEIELKKIARNHPNAKVLLHIATEDNIggEDGNMKFGTTLKNCRHLLECAK 185 house mouse
NP_001087651 106 ENVVYTNPCKQASQIKHAAKIGVNLMTCDSETELKKIARNHLNAKLLLHVATEGMSgeEEMSMTFGTTLKNCRHLLDCAK 185 African clawed ...
CAD87803     106 ENIILSGVCKQLSLIKHAAKTGINFLLCENEAELRKIARAHPEAKLLLQVSTEAQI--EEASVTIGCSLKGCRHLLELAK 183 zebrafish
NP_001008729 106 ENIIYTNPCKQASQIKYAAKAGINIMTCDSDIELKKIARNHPNAKLLLHIATEDITadEEMNMKFGTTLKNCRHLMECAK 185 chicken
Feature 1                                                                                        
3BTN_A       186 ELDVQIIGVKFHVSSACkEYQVYVHALSDARCVFDMAGEFGFTMNMLDIGGGFTGtEIQLEEVNHVISPLLDIYFPEGSG 265 house mouse
3BTN_B       186 ELDVQIIGVKFHVSSACkEYQVYVHALSDARCVFDMAGEFGFTMNMLDIGGGFTGtEIQLEEVNHVISPLLDIYFPEGSG 265 house mouse
NP_001087651 186 ELSVEVVGVKFHVSNSS-NQQTYNHALSDARCVFDMAEELGFKMNILDIGGIPEN-EAQLEELYQAVGPLLDVYFPEGSG 263 African clawed ...
CAD87803     184 ELNVSVAGVTFQVPASCkDPQAYTHALSDARCIFDMGKELGFDMNILDIGGGFSGsEFQLKQVHSVIRPLLEAYFPSESG 263 zebrafish
NP_001008729 186 EFGVQIVGVKFHVSGSCkELQTYIHAISDARCVFDMAEEFGFKMNMLDIGGGFTGsELQLEEVNHVIRPLLDVYFPKESG 265 chicken
Feature 1                              #                                          #              
3BTN_A       266 IQIISEPGSYYVSSAFTLAVNIIAKKVVENDKFSSGVEKn--gSDEPAFVYYMNDGVYGSFASKLSEDLNTIPEVHKKYk 343 house mouse
3BTN_B       266 IQIISEPGSYYVSSAFTLAVNIIAKKVVENDKFSSGVEKn--gSDEPAFVYYMNDGVYGSFASKLSEDLNTIPEVHKKYk 343 house mouse
NP_001087651 264 TRIIAEPGSFYVSSAFTLAVNVIAKETIEHDHHLSSAGKp--iSNKLAFVYCLNEGVYGSFARKLFEKLDTTPEVHKKYk 341 African clawed ...
CAD87803     264 VSIIAEPGNFFVFSCFTLAVNVIGKKAAYRNLHTSTHDKlt-sSDAPEFVYYMNDGVYGSFMGRLFGNIISTPSVHKMSl 342 zebrafish
NP_001008729 266 IQVIAEPGCYYVSSAFTLAVNVIAKKAVDCDKLLPSGVEqarnDDEPVFTYYINDGVYGSFASKLSEKLYTNPEVHKKYk 345 chicken
Feature 1                       # #                              #  #  #                      
3BTN_A       344 -eDEPLFTSSLWGPSCDELDQIVESCLLPELNVGDWLIFDNMGADSFHEPSAFNDFQRPAIYFMMSFSDWYEMQDAG 419 house mouse
3BTN_B       344 -eDEPLFTSSLWGPSCDELDQIVESCLLPELNVGDWLIFDNMGADSFHEPSAFNDFQRPAIYFMMSFSDWYEMQDAG 419 house mouse
NP_001087651 342 -dGEPLFTSSLLGASYDELDVIVDHCVLPELEVGDWIVFENMGCGSLNENSPFADFEKPSLYNFMSFNDWYGIQDTG 417 African clawed frog
CAD87803     343 tlDEPVFSSSLWGPSCDPLDQVVERCLLPELAVGDWLVFSNMGASGQEGPATFSDTDQPPVYYTISTDDWFEMQEAG 419 zebrafish
NP_001008729 346 -eDEPLFASSLWGPSCDELDQIVENCLLPELSVGDWLIFDNMGSGTLGEQSTFNDYQRPLIYYMMSFSDWDEMQDAG 421 chicken

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap