Conserved Protein Domain Family

cd06830: PLPDE_III_ADC 
Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Arginine Decarboxylase
This subfamily includes plants and biosynthetic prokaryotic arginine decarboxylases (ADC, EC ADC is involved in the biosynthesis of putrescine, which is the precursor of aliphatic polyamines in many organisms. It catalyzes the decarboxylation of L-arginine to agmatine, which is then hydrolyzed to putrescine by agmatinase. ADC is homologous to eukaryotic ornithine decarboxylase (ODC) and diaminopimelate decarboxylase (DapDC), which are fold type III PLP-dependent enzymes that contain an N-terminal PLP-binding TIM-barrel domain and a C-terminal beta-sandwich domain, similar to bacterial alanine racemases. Homodimer formation and the presence of both PLP and Mg2+ cofactors may be required for catalytic activity. Prokaryotic ADCs (biodegradative), which are fold type I PLP-dependent enzymes, are not included in this family.
PSSM-Id: 143503
Aligned: 37 rows
Threshold Bit Score: 425.446
Threshold Setting Gi: 151571673
Created: 28-Feb-2008
Updated: 2-Oct-2020
Aligned Rows:
Feature 1:active site [active site]
  • Comment:Based on the structures of PLP and substrate bound to ornithine and diaminopimelate decarboxylases.
  • Comment:The active site is composed of residues from both subunits of the dimer. There are two active sites in the functional dimer.

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                   # #                        #         
Feature 1                          #                                                       #     
Feature 1                                                    #  #                                
Feature 1            ##                                               ####                       
Feature 1                                                                                        
Q7NE10       362 pepparnehsiirnlyetytqitpdnvqeafndasqfkeeal---slfalgylglgeraraerlywgccekilnlvreld 438 Gloeobacter vio...
NP_223679    351 kslkikennnpplidemldllanineknaieylhdsfdhtes---lftlfdlgyidlidrsntevlahlivkkavqlfyv 427 Helicobacter py...
YP_843948    358 vafplegdpiqiedlyfafkninlknykeyyhdalhyrdell---dsfnlgnigleerakgemlfwmvcqkavslarhag 434 Methanosaeta th...
YP_863630        --------------------------------------------------------------------------------     Gramella forset...
YP_001040225 343 rgetsypiveeikntenikelvyvsrkarevitrlmlkfpiniesrrileklltsineaitskayeiihrdndkaleeli 422 Staphylothermus...
ZP_01718184      --------------------------------------------------------------------------------     Algoriphagus sp...
YP_001277158     --------------------------------------------------------------------------------     Roseiflexus sp....
ZP_01886545      --------------------------------------------------------------------------------     Pedobacter sp. ...
ZP_01908990  402 peaspaedrlitslrecleyinvknieeyfhdavdyrdealq----lfsrgylsledrasaeglfqrirmrcaklirqmr 477 Plesiocystis pa...
EDN37327     314 neilhqqwldr-----------------------------------------------------------------evsl 328 Francisella tul...
Feature 1                                                                    ##                  
Feature 1                                                             #   #       #           
Q7NE10       511 RDvkgvle--------------------------lhpvrpEEPYYLGMFLNGAYQEILGD----MHNLFGDTNTVHI 557 Gloeobacter violaceus
NP_223679    500 PLflhd------------------------------ididEEEYFLAFFLVGAYQEVLGM----KHNLFTHPTEFSV 542 Helicobacter pylor...
YP_843948    507 KEaielh-----------------------------klsrSEDYYMGIFLLGAYQDTLGD----FHNLLGCVTEVHV 550 Methanosaeta therm...
YP_863630    389 NAiylp------------------------------kfkkEKPLYIGFFNTGAYQDTIGGfgglQHCLIPQPKHILI 435 Gramella forsetii ...
YP_001040225 495 LPnnieyetedlftsldhklmfipgktlrlkgvplhiprkNEDYYIAFLDTGAYQDMLSM----NHNLLNGYPEIII 567 Staphylothermus ma...
ZP_01718184  429 PDn-------------------------------------GKKQYLGFFHTGAYQESLGGyggiQHCLIPAPKHVLI 468 Algoriphagus sp. PR1
YP_001277158 400 PLllp---------------------------------dpYPGQKIAFFGVGAYQQMIAGrggaHHCLTPEMRRIII 443 Roseiflexus sp. RS-1
ZP_01886545  396 KT--------------------------------------RKVQYLGFFNTGAYQEVLSGyggiHHCLLPSPKHVII 434 Pedobacter sp. BAL39
ZP_01908990  550 DDnlkslpl------------------------happarnDEPYFLGFFMTGAYQDSLAN----AHNLFGRCHEVIV 598 Plesiocystis pacif...
EDN37327     401 IEia-----------------------------------tDNIEYIVFMCVGAYQGMLSA----KHNMLGNISAVNI 438 Francisella tulare...

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap