Conserved Protein Domain Family
PLPDE_III_LS_D-TA_like

?
cd06820: PLPDE_III_LS_D-TA_like 
Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes, Low Specificity D-Threonine Aldolase-like
This subfamily is composed of uncharacterized bacterial proteins with similarity to low specificity D-threonine aldolase (D-TA), which is a fold type III PLP-dependent enzyme that catalyzes the interconversion between D-threonine/D-allo-threonine and glycine plus acetaldehyde. Both PLP and divalent cations (eg. Mn2+) are required for catalytic activity. Low specificity D-TAs show similarity to bacterial alanine racemase (AR), which contains an N-terminal PLP-binding TIM-barrel domain and a C-terminal beta-sandwich domain. AR exists as homodimers with active sites that lie at the interface between the TIM barrel domain of one subunit and the beta-sandwich domain of the other subunit. Based on its similarity to AR, it is possible that low specificity D-TAs also form dimers in solution. Experimental data show that the monomeric form of low specificity D-TAs exhibit full catalytic activity.
Statistics
?
PSSM-Id: 143494
View PSSM: cd06820
Aligned: 16 rows
Threshold Bit Score: 425.19
Threshold Setting Gi: 162431467
Created: 18-Jun-2008
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
Feature 1:active site [active site]
Evidence:
  • Comment:Based on the binding of the PLP cofactor and substrate analogs to other members of the superfamily.
  • Comment:The active site is composed of residues from both subunits of the dimer. There are two active sites in the functional dimer.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                         # #                   #                      # 
BAC00003      40 IDTPAVLIDRERLTANISRMAAHAGAHEIALRPHVKTHKIIEIAQMQVDAGARGITCATIGEAEIFAGAGf--TDIFIAY 117 Corynebacterium...
YP_946033      8 VITPAVLIDVDVLDRNIERMAGNMRGRGLQLRPHVKTHKTLEIARKQLAAGALGITVATIGEAEVFAADGv--KDIFIAF 85  Arthrobacter au...
YP_079923      6 LDTPALLIDKDVMLSNMKDMQNYANEQKVSLRPHTKTHKMPKLAKLQEEMGAVGIAVAKVGEAEVMARNGl--KDIFIAN 83  Bacillus lichen...
ZP_01859272    7 LDTPTLLLDYQKLMKNINEIASFAKEHSLSYRPHIKTHKSVEIAKLQLQAGAIGITTATIPEAEAMAAGGi--NDILIAY 84  Bacillus sp. SG-1
ZP_01093183   13 ISTPAMVIDLPIVEKNLQKLHSYADQHGLHVRPHTKTHKSRYFARMQLKQGSSGLTVAKVGEAEVMALES---SDILIAY 89  Blastopirellula...
YP_631327      9 MTTPAALVDLDRVDANLKRVAMYTRQHGLRWRPHTKTHKTPEFAALQLAAGAQGVTVATVREAEVMATVC---DDILLAY 85  Myxococcus xant...
YP_001701995  13 LDTPFLAVDLAVMDRNIERLAGRLRGTGIRLRPHAKSHKCIEIARRQIDSGAIGLTVATVGEAEVFAEAGf--IDLFIAY 90  Mycobacterium a...
YP_923879      8 PATPYLRVDVARLRANIERTTRWAAAGGVSLRPHAKTHKSPDIARLQLAAGAIGLTVATIGEAEVFVEHGa--EDVFVAY 85  Nocardioides sp...
YP_446532      6 LSTPALLIEQSRLQENLAAMQATADANDVTLRPHVKTHKSVAIAEQQQQRGAEGLTVATVHEAETFVAAGf--DDVRVAY 83  Salinibacter ru...
NP_437253      5 IETPAVLVDLDIARRNVLAFQAYADRHGIRVRPHIKTHKLPQMAELQLDAGAIGITCQKVTEAEAMVDGGariKDVLITY 84  Sinorhizobium m...
Feature 1                                                              #      #                  
BAC00003     118 PLyLTDHAVQRLNAIPGE---ISIGVDSV----EMAQATAGLRe----DIKALIEVDSGHRRSGVT----ATASELSQIr 182 Corynebacterium...
YP_946033     86 PLwVEAPHAERLRALTAKc-rLAVGVDSAesatAMGRQLGVDAg----SVEVLIEVDSGHHRSGVLp---DEVVDVAEAa 157 Arthrobacter au...
YP_079923     84 EI-VGKSKLERIRKLSETi-dISFGIDSA----YQVREIEEVFegaskKAQVLVEIEVGEQRSGIIe--eDDFRTLLELi 155 Bacillus lichen...
ZP_01859272   85 PI-ASPQKIKRLIALLEQdvkLKISVDNP----VQLTHLQNELehtpfTLEVWIKVNSGLNRCGVEp--gKDAVALAKNi 157 Bacillus sp. SG-1
ZP_01093183   90 PA-IDPDRRRRLAQLAQQh-tVRVAVDSA----YGVSALAAAAqeagsTIGILVDVNVGMNRTGVSt--pVEALQLAQQi 161 Blastopirellula...
YP_631327     86 PP-VGDDRLTRLMALPPHv-rLTVALDSGea-lEMLSRAARRAg---rTVGVLVELDLGMRRVGVQs--pEDAVALARAv 157 Myxococcus xant...
YP_001701995  91 PLwVTAQKARRLRQVASRa-aLRVAVDSA----AGAQQLAEHLgd--lPITVVIEVDSGHHRTGVAp---DQAGPVAAAa 160 Mycobacterium a...
YP_923879     86 PLwLTENGARRLRDLADRa-dLAIGVDSA----EGARLAARLLeg--sGVVALVEVDSGQHRSGVDa---EDAGTVAAAa 155 Nocardioides sp...
YP_446532     84 PV-VGRPKHERLRALRAAa-tLSFTVDTM----AGADQASAVYagadnPVEVLMEVDVGHGRCGVHwaddAAAVALAQHi 157 Salinibacter ru...
NP_437253     85 NL-LGEQKLARLARLNERv-tVSVVADNA----TVVDGLAAFFadagkPLTVLVECNTGADRCGVGt--pSEAARLARRi 156 Sinorhizobium m...
Feature 1                      #                                                           ##    
BAC00003     183 e--aLGSRYAGVFTFPGHsygpg--------ngeqAAADELQALNNSVqr---------------laGGLTSGGSSPSAq 237 Corynebacterium...
YP_946033    158 a--aAGLSVQGVFTFPGHsykpg--------mptgAASNENEALGLAAtalts----------agfeVTTISGGSTPTAl 217 Arthrobacter au...
YP_079923    156 k-tcQNVELKGIFSHDGHsykaks-----vahckeLYKESVERTLHFAriaee----------mdlkPKVVSIGSTPPFm 219 Bacillus lichen...
ZP_01859272  158 m-gcTKLKLGGILTHAGHs---------------yAASSYAEIERIGNlegktvvesaeecekagipIPVRSVGSTPTYk 221 Bacillus sp. SG-1
ZP_01093183  162 aqseNSLRLDGIFFYPGHiw--------------rPADEQAEPLRQVDailaevit---lweshglsANIVSGGSTPTAy 224 Blastopirellula...
YP_631327    158 t-ssSGLEYRGITFYAGHlrmpq--------aelgDAMREQSVRLATYvdtla---------daglrPKTVSGGSTPTLw 219 Myxococcus xant...
YP_001701995 161 r--sAGLNVVGIFTFPGHgytpg--------hraeVAAQESHALDTAAaslra----------qgidPSVRSGGSTPTVg 220 Mycobacterium a...
YP_923879    156 v--eAGLPVRGVFTFPGHsyspd--------alrsAADDEARVLRAATeslrs----------fglePDVVSGGSTPSLa 215 Nocardioides sp...
YP_446532    158 a-slPGLQLAGILTHAGQaydgpsddetakgalrrAARHERDRMLSVAcalaead-----gvdvtpdDLEISVGSTPSMa 231 Salinibacter ru...
NP_437253    157 a-eaPGLRFGGLMTYPPAdgaa----------rvqAFMSDAKRLIEAEgl----------------eVPCITSGGTPGMm 209 Sinorhizobium m...
Feature 1                       ####                                              #              
BAC00003     238 ft-------daIDEMRPGVYVFNDSQQITsGACTEKQVAMTVLSTVVSRNVsd----rRIILDAGSKILSTDkp----aw 302 Corynebacterium...
YP_946033    218 idg-----etvATELRPGVYVFGDAQQLElERCSWDDIALSVAATVVSRHEarggnvrRVVLDAGSKILGSDrp----dw 288 Arthrobacter au...
YP_079923    220 fkfd---ipegVTEIRPGTYIFMDASQAN-VIGTYDRCAASVLTTVISKPTk-----eRVITDVGAKGITAQtrseglta 290 Bacillus lichen...
ZP_01859272  222 isg----nvpgITEIRPGNAVFFDSIQAGlGVTSLENCALTVLASVVGVYSn------RIVLDTGSKTLCLDkgahgnet 291 Bacillus sp. SG-1
ZP_01093183  225 qsh----llpsQTEIRPGTNIFNDMNTVRaGYCELSECAVAIICTVVSTAVp-----gKCVIDAGTKTLTSDrnv--tqp 293 Blastopirellula...
YP_631327    220 rsh----evagLTEIRPGINIFNDRNAVSvGACPWEECAYSVLATVVSTTVp-----gQAVIDAGSKALAKEegf---td 287 Myxococcus xant...
YP_001701995 221 aad-----dtvLTEVRPGVYPFNDAQQLElDVCTLDDIALSAVTTVVHARGr------TAVVDAGSKILGADrp----gw 285 Mycobacterium a...
YP_923879    216 hth-----tdeLTELRPGVYAFGDAQQWElGSAAPDDLALTCRATVVSHAGg------RLVLDAGSKALGADra----ay 280 Nocardioides sp...
YP_446532    232 afenatrdgfrVTEIRPGNYVMHDAMQVAlGAAPLGDCALTVLTTVVSTQQkpd-gtaHAFVDAGKKVFTTDtg----yg 306 Salinibacter ru...
NP_437253    210 qaa----eapiASEHRPGTYIYNDRSLVArGVASWEDCALTVLATVVSVPSe-----nRAIIDAGSKVLTSDll-----g 275 Sinorhizobium m...
Feature 1                                                                                        
BAC00003     303 IDGNGFv-------LGNPEARISaLSEHHATIfwpdkvllPVIGEQLNIVPNHACNVINLVDEVYv---READGTFRTWK 372 Corynebacterium...
YP_946033    289 ATGYGRl-------PEYPEAKVTaLSEHHATVvwpdsselPPLGTRLRVIPNHVCLTMNLVDQVIv---VHGGAVAERWT 358 Arthrobacter au...
YP_079923    291 TKGLGRi-------KEYEDVYIHgVFDEHAIIyheefnkkVSIGDKVRIIPNHICPVCNLHDKAYl---VDNGEVVDELN 360 Bacillus lichen...
ZP_01859272  292 VRGFGHi-------IGHPEITVErLSEEHGVGtftg-egsLKLNDKVQIIPNHACTVANQFEEYAv---HEEGKVITTWK 360 Bacillus sp. SG-1
ZP_01093183  294 DSGHGHv-------LEYPRGKIVrLSEEHGEIdfadcdtlPKIGERLTVIPNHICPCVNLQNQVYl---QTPEKTIAMTD 363 Blastopirellula...
YP_631327    288 TGVYGAl-------LDRPDVLVRgLSEEHGLLdlsstdwrPRVGDRVRVVPNHACASVNLHDRLHl---LRQSTWAGTHA 357 Myxococcus xant...
YP_001701995 286 ATGFGRv-------IDEPDARIVaLSEHHATIefp--gaaPPPGTRLRVAPNHLCNAVNLVDSLV----IDAADGVRHWA 352 Mycobacterium a...
YP_923879    281 ATGWGRl-------PAYPDARVVqLSEHHAVVdltg-aplPRLGSRVDVVPNHVCAAVNLADTLWadhgPDGSDALEPWP 352 Nocardioides sp...
YP_446532    307 TDGHGIaladaaqmRPHPGLRVDhLSEEHGWLtmtg-dadLTVGDRLRIVPNHACVTVANQDTLHv---VDGPSVVDAWS 382 Salinibacter ru...
NP_437253    276 LTGYGHv-------LGRDDIRIDqLSEEHGRLvsdg-qigLQVGELVRIVPNHACVVTNMVDAVHv---IEGGAPKGTWP 344 Sinorhizobium m...
Feature 1             
BAC00003     373 VVARG 377 Corynebacterium glutamicum ATCC 13032
YP_946033    359 VAARG 363 Arthrobacter aurescens TC1
YP_079923    361 IEARG 365 Bacillus licheniformis ATCC 14580
ZP_01859272  361 VERKK 365 Bacillus sp. SG-1
ZP_01093183  364 IDTRG 368 Blastopirellula marina DSM 3645
YP_631327    358 ITARG 362 Myxococcus xanthus DK 1622
YP_001701995 353 VAARG 357 Mycobacterium abscessus
YP_923879    353 VTARG 357 Nocardioides sp. JS614
YP_446532    383 VDARG 387 Salinibacter ruber DSM 13855
NP_437253    345 VVARG 349 Sinorhizobium meliloti 1021

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap