2Q0N,2CDZ,2X4Z


Conserved Protein Domain Family
STKc_PAK4

?
cd06657: STKc_PAK4 
Click on image for an interactive view with Cn3D
Catalytic domain of the Serine/Threonine Kinase, p21-activated kinase 4
STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. PAK4 regulates cell morphology and cytoskeletal organization. It is essential for embryonic viability and proper neural development. Mice lacking PAK4 die due to defects in the fetal heart. In addition, their spinal cord motor neurons showed failure to differentiate and migrate. PAK4 also plays a role in cell survival and tumorigenesis. It is overexpressed in many primary tumors including colon, esophageal, and mammary tumors. PAK4 has also been implicated in viral and bacterial infection pathways. PAK4 belongs to the group II PAKs, which contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.
Statistics
?
PSSM-Id: 132988
View PSSM: cd06657
Aligned: 6 rows
Threshold Bit Score: 573.508
Threshold Setting Gi: 363746159
Created: 16-Nov-2007
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 22 residues -Click on image for an interactive view with Cn3D
Feature 1:ATP binding site [chemical binding site]
Evidence:
  • Structure:2CDZ; Human PAK4 binds the purine-based inhibitor Cgp74514a; defined at 4A contacts.
    View structure with Cn3D
  • Structure:2X4Z; Human PAK4 binds inhibitor Pf-03758309; contacts at 4A.
    View structure with Cn3D
  • Comment:Also based on the structure of PAK5 bound to purine-based inhibitor that mimics the binding of ATP, and on the binding of other related proteins with structure to ATP or inhibitors.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                   #####   #            # #                            #
2Q0N_A        10 SHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVV 89  human
2CDZ_A        12 SHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVV 91  human
2X4Z_A         5 SHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVV 84  human
CAC40979     359 SHEQFRAALQMVVDPGDPRTYLDNFIKIGEGSTGIVCIATIKSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVV 438 African clawed ...
NP_001002222 372 SHEQFRAALQMVVDPGDPRTYLDHYIKIGEGSTGIVCIATVKTTGKLVAVKKMDLRKQQRRELLFNEVVIMRDYHHENVV 451 zebrafish
XP_001233796 267 SHEQFRAALQMVVDPGDPRTYLDNFIKIGEGSTGIVCIATVKSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVV 346 chicken
Feature 1                       ##### ##  #                                      ## #         ## 
2Q0N_A        90 EMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDF 169 human
2CDZ_A        92 EMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDF 171 human
2X4Z_A        85 EMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDF 164 human
CAC40979     439 EMYNSYLVGDELWVIMEFLEGGALTDIVTHTRMNEEQIATVCVSVLKALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDF 518 African clawed ...
NP_001002222 452 EMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQISTVCLSVLKALSVLHSQGVIHRDIKSDSILLTHDGRVKLSDF 531 zebrafish
XP_001233796 347 EMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLKALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDF 426 chicken
Feature 1                                                                                        
2Q0N_A       170 GFCAQVSKEVPRRKXLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLH 249 human
2CDZ_A       172 GFCAQVSKEVPRRKXLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLH 251 human
2X4Z_A       165 GFCAQVSKEVPRRKXLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLH 244 human
CAC40979     519 GFCAQVNKEVPRRKSLVGTPYWMAPELISRLPYGPEVDVWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPKLKNAQ 598 African clawed ...
NP_001002222 532 GFCAQVSKEVQRRKSLVGTPYWMAPELISRLPYGPEVDIWSFGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPKLKNLH 611 zebrafish
XP_001233796 427 GFCAQVNKEVPRRKSLVGTPYWMAPELISRLPYGPEVDIWSLGVMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPKLKNVH 506 chicken
Feature 1                                                            
2Q0N_A       250 KVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNRTR 301 human
2CDZ_A       252 KVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNRTR 303 human
2X4Z_A       245 KVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNRTR 296 human
CAC40979     599 KVSPLLKGFLDRLLVRDPSQRASANELLKHPFLGKAGPPSCIVPLMRQNRMR 650 African clawed frog
NP_001002222 612 KVSPLLKGFLDRMLVRDPAQRATAQELLKHPFLTKAGPPSCIVPLMRQNRMR 663 zebrafish
XP_001233796 507 KVSPSLKGFLDRMLVRDPVQRATANELLKHPFLGKAGPPSCIVPLMRQNRMR 558 chicken

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap